DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and sto-1

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_509281.1 Gene:sto-1 / 181017 WormBaseID:WBGene00006063 Length:330 Species:Caenorhabditis elegans


Alignment Length:282 Identity:78/282 - (27%)
Similarity:139/282 - (49%) Gaps:51/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PIN--MCVMFVPQQEAWVVERMGRF-HRILDPGLNILVPVADKIKYVQSLKEIAIDVPKQSAITS 99
            |::  ||:..|.:.:..||.|:||. ..:..||:..::|..|....: .|:..:.:||.|..::.
 Worm    57 PVSVFMCIKIVQEYQRAVVFRLGRLVPDVKGPGIFFIIPCIDTFLNI-DLRVASYNVPSQEILSR 120

  Fly   100 DNVTLSIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVD 164
            |:||:|:|.|:|.::.||..:..||.:...:...|||||:|:.||..::.::..:||.::..:..
 Worm   121 DSVTVSVDAVVYFKVFDPITSVVGVGNATDSTKLLAQTTLRTILGTHTLSEILSDREKISADMKI 185

  Fly   165 SINKASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEGKRKS 229
            |:::|:|.|||...|.|:||:|||:::..||..:.||.|...|.|:.:||...|...:|      
 Worm   186 SLDEATEPWGIKVERVELRDVRLPSQMQRAMAAEAEATRDAGAKIIAAEGELRASAALA------ 244

  Fly   230 RILASEAERQEHINKASGEAAAIIAVADARARSLLAIAKSLSHLDGQNAASLTLAEQYIGAFKKL 294
                              |||.||:.::.        |..|.:|...||.|              
 Worm   245 ------------------EAATIISKSEG--------AMQLRYLHTLNAIS-------------- 269

  Fly   295 AKTNNTMILPSNPGDVNGFVAQ 316
            ::..:|:|.|. |.::.|.:::
 Worm   270 SEKTSTIIFPF-PMEILGGISK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 52/158 (33%)
SPFH_paraslipin 80..188 CDD:259811 36/107 (34%)
Band_7_C 266..326 CDD:292817 11/51 (22%)
sto-1NP_509281.1 PHB 62..220 CDD:214581 52/158 (33%)
SPFH_like 86..283 CDD:302763 68/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.