DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and unc-24

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001355386.1 Gene:unc-24 / 177594 WormBaseID:WBGene00006761 Length:443 Species:Caenorhabditis elegans


Alignment Length:166 Identity:41/166 - (24%)
Similarity:77/166 - (46%) Gaps:29/166 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PINM--CVMFVPQQEAWVVERMGRFHRILDPGLNILVPVADKIKYVQSLKEIAIDVPKQSAITSD 100
            |:::  .:.|:...|..||.|:||..:...||:.:::|..|....| ::...|.:||....||:|
 Worm   124 PLSLLFALKFISTSEKLVVLRLGRAQKTRGPGITLVIPCIDTTHKV-TMSITAFNVPPLQIITTD 187

  Fly   101 NVTLSIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTM----------RSELG----------- 144
            ...:.:...::|:|.||..|..||:|...::..||.|.:          ..|||           
 Worm   188 RGLVELGATVFLKIRDPIAAVCGVQDRNASVRTLANTMLYRYISKKRICDDELGSFTCQFGVEIT 252

  Fly   145 --KMSMDKVFRERESLNVSIVDSINKA---SEAWGI 175
              ::|..|:.:|.|::.:|.:.|:.|:   .:.|.:
 Worm   253 DVEISDVKIVKEGENMGMSALSSVAKSDAGQQLWQV 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 40/163 (25%)
SPFH_paraslipin 80..188 CDD:259811 29/122 (24%)
Band_7_C 266..326 CDD:292817
unc-24NP_001355386.1 SPFH_like 146..263 CDD:388510 29/117 (25%)
SCP2 338..437 CDD:376720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.