DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and phb-2

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_495250.2 Gene:phb-2 / 174034 WormBaseID:WBGene00004015 Length:294 Species:Caenorhabditis elegans


Alignment Length:116 Identity:18/116 - (15%)
Similarity:55/116 - (47%) Gaps:3/116 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 EFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVDSINKASEAWGIACLRYEIRDIRLPTRVH 192
            |..:..:....::..:.|.:..::..:|:.:::.:..::.:.:..:.|......:.::....:..
 Worm   129 ERVLPSICNEVLKGVVAKFNASQLITQRQQVSMLVRKTLIERALDFNIILDDVSLTELAFSPQYS 193

  Fly   193 EAMQ-MQVEAERRKRAA--ILESEGVREAEINIAEGKRKSRILASEAERQE 240
            .|:: .||.|:..:||.  :..::..::.:|..|||:.:|..|..||.:.:
 Worm   194 AAVEAKQVAAQEAQRATFYVERAKQQKQEKIVQAEGEAESAKLLGEAMKND 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 5/71 (7%)
SPFH_paraslipin 80..188 CDD:259811 4/59 (7%)
Band_7_C 266..326 CDD:292817
phb-2NP_495250.2 PHB 39..200 CDD:214581 5/70 (7%)
SPFH_prohibitin 40..234 CDD:259799 14/104 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.