DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and phb-1

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_490929.1 Gene:phb-1 / 171768 WormBaseID:WBGene00004014 Length:275 Species:Caenorhabditis elegans


Alignment Length:269 Identity:55/269 - (20%)
Similarity:106/269 - (39%) Gaps:50/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 QEAWVVERM-GRFHRILDPGLNILVPVADK--IKYVQSLKEIAIDVPKQSAITSDNVTLSI---- 106
            |.|.:.:|. |..:.::..|.:.|:|...|  |..::|.......:.....:.:.|:||.|    
 Worm    37 QRAVIFDRFSGVKNEVVGEGTHFLIPWVQKPIIFDIRSTPRAVTTITGSKDLQNVNITLRILHRP 101

  Fly   107 --DGV--LYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVDSIN 167
              |.:  :||.|        |::..|..:..:....:::.:.:....::..:||.::.....::.
 Worm   102 SPDRLPNIYLNI--------GLDYAERVLPSITNEVLKAVVAQFDAHEMITQREVVSQRASVALR 158

  Fly   168 KASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEGKRKSRIL 232
            :.:..:|:......|..:.......||::|:..|:             :|||        |:|.|
 Worm   159 ERAAQFGLLLDDIAITHLNFGREFTEAVEMKQVAQ-------------QEAE--------KARYL 202

  Fly   233 ASEAERQEHINKASGEAAAIIAVADARARSLLAIAKSLSHLDGQNAASLTLAEQYIGAFKKLAKT 297
            ..:||:.:       .||...|..||:|..|||.|.:.:   |.....|...|......:::||.
 Worm   203 VEKAEQMK-------IAAVTTAEGDAQAAKLLAKAFASA---GDGLVELRKIEAAEEIAERMAKN 257

  Fly   298 NNTMILPSN 306
            .|...||.|
 Worm   258 KNVTYLPGN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 27/160 (17%)
SPFH_paraslipin 80..188 CDD:259811 15/115 (13%)
Band_7_C 266..326 CDD:292817 10/41 (24%)
phb-1NP_490929.1 PHB 29..190 CDD:214581 27/160 (17%)
SPFH_prohibitin 30..220 CDD:259799 39/218 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.