DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and Nphs2

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_569723.1 Gene:Nphs2 / 170484 MGIID:2157018 Length:385 Species:Mus musculus


Alignment Length:288 Identity:69/288 - (23%)
Similarity:125/288 - (43%) Gaps:46/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 CVMFVPQQEAWVVERMGRF--HRILDPGLNILVPVADKIKYVQSLKEIAIDVPKQSAITSDNVTL 104
            |:..|.:.|..::.|:|..  .|...|||...:|..|....| .|:...:::|....:|.|...:
Mouse   126 CIKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKV-DLRLQTLEIPFHEVVTKDMFIM 189

  Fly   105 SIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVDSINKA 169
            .||.|.|.|:.:.......:.....||..|.||||:..|...|:.::..||:|:...:..:::..
Mouse   190 EIDAVCYYRMENASLLLSSLAHVSKAIQFLVQTTMKRLLAHRSLTEILLERKSIAQDVKVALDAV 254

  Fly   170 SEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEGKRKSRILAS 234
            :..|||...|.||:|:|||..:..::.::.||:|:.:..::.:||.:.|.        :|..:|:
Mouse   255 TCIWGIKVERTEIKDVRLPAGLQHSLAVEAEAQRQAKVRVIAAEGEKAAS--------ESLRMAA 311

  Fly   235 EAERQEHINKASGEAAAIIAVADARARSLLAIAKSLSHLDGQNAASLTLAEQYIGAFKKLAKTNN 299
            |.        .||..||:          .|....:|..|..:..|::.|...:           :
Mouse   312 EI--------LSGTPAAV----------QLRYLHTLQSLSTEKPATVVLPLPF-----------D 347

  Fly   300 TMILPSNPGDVNGFVAQALAVYNHVSNS 327
            .:.|.|:||:      :|....|:.|:|
Mouse   348 MLSLLSSPGN------RAQGSINYPSSS 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 43/158 (27%)
SPFH_paraslipin 80..188 CDD:259811 30/107 (28%)
Band_7_C 266..326 CDD:292817 10/59 (17%)
Nphs2NP_569723.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64
SPFH_podocin 124..346 CDD:259809 61/246 (25%)
PHB 125..289 CDD:214581 45/163 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..385 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.