DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and Stom

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_038543.1 Gene:Stom / 13830 MGIID:95403 Length:284 Species:Mus musculus


Alignment Length:206 Identity:64/206 - (31%)
Similarity:120/206 - (58%) Gaps:15/206 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PIN--MCVMFVPQQEAWVVERMGRFHRILD-----PGLNILVPVADKIKYVQSLKEIAIDVPKQS 95
            ||:  :|:..|.:.|..::.|:|   |||.     |||..::|..|.:..| .::.|:.|:|.|.
Mouse    47 PISIWICIKIVKEYERVIIFRLG---RILQGGAKGPGLFFILPCTDSLIKV-DMRTISFDIPPQE 107

  Fly    96 AITSDNVTLSIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNV 160
            .:|.|:||:|:|||:|.|:.:...|...:.:.:.|...|||||:|:.||..::.::..:||.:..
Mouse   108 VLTKDSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNALGTKNLSQILSDREEIAH 172

  Fly   161 SIVDSINKASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEG 225
            .:..:::.|::.|||...|.||:|::||.::..||..:.||.|..||.::.:||    |:|.:..
Mouse   173 HMQSTLDDATDDWGIKVERVEIKDVKLPVQLQRAMAAEAEAAREARAKVIAAEG----EMNASRA 233

  Fly   226 KRKSRILASEA 236
            .:::.::.:|:
Mouse   234 LKEASMVITES 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 52/162 (32%)
SPFH_paraslipin 80..188 CDD:259811 35/107 (33%)
Band_7_C 266..326 CDD:292817
StomNP_038543.1 PHB 53..204 CDD:214581 50/154 (32%)
SPFH_stomatin 73..274 CDD:259801 54/177 (31%)
Required for homooligomerization. /evidence=ECO:0000250 265..273
Required for lipid raft association. /evidence=ECO:0000250 267..269
Interaction with LANCL1. /evidence=ECO:0000250 273..284
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.