Sequence 1: | NP_001261161.1 | Gene: | Stoml2 / 37807 | FlyBaseID: | FBgn0034936 | Length: | 366 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038543.1 | Gene: | Stom / 13830 | MGIID: | 95403 | Length: | 284 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 64/206 - (31%) |
---|---|---|---|
Similarity: | 120/206 - (58%) | Gaps: | 15/206 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 PIN--MCVMFVPQQEAWVVERMGRFHRILD-----PGLNILVPVADKIKYVQSLKEIAIDVPKQS 95
Fly 96 AITSDNVTLSIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNV 160
Fly 161 SIVDSINKASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEG 225
Fly 226 KRKSRILASEA 236 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Stoml2 | NP_001261161.1 | PHB | 41..199 | CDD:214581 | 52/162 (32%) |
SPFH_paraslipin | 80..188 | CDD:259811 | 35/107 (33%) | ||
Band_7_C | 266..326 | CDD:292817 | |||
Stom | NP_038543.1 | PHB | 53..204 | CDD:214581 | 50/154 (32%) |
SPFH_stomatin | 73..274 | CDD:259801 | 54/177 (31%) | ||
Required for homooligomerization. /evidence=ECO:0000250 | 265..273 | ||||
Required for lipid raft association. /evidence=ECO:0000250 | 267..269 | ||||
Interaction with LANCL1. /evidence=ECO:0000250 | 273..284 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0330 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |