DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stoml2 and PHB2

DIOPT Version :9

Sequence 1:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001138303.1 Gene:PHB2 / 11331 HGNCID:30306 Length:299 Species:Homo sapiens


Alignment Length:246 Identity:46/246 - (18%)
Similarity:99/246 - (40%) Gaps:60/246 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ILDPGLNILVPVADKIKYVQSLKEIAIDV---PKQSAITSDNVTLSIDGVLYLRIIDPYKAS--- 121
            ||..||:..:|   ..:|     .|..|:   |::.:..:.:..|.:..: .||::....|.   
Human    63 ILAEGLHFRIP---WFQY-----PIIYDIRARPRKISSPTGSKDLQMVNI-SLRVLSRPNAQELP 118

  Fly   122 -----YGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVDSINKASEAWGIACLRYE 181
                 .|::..|..:..:....::|.:.|.:..::..:|..:::.|...:.:.::.:.:......
Human   119 SMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVA 183

  Fly   182 IRDI---RLPTRVHEAMQM-QVEAERRKRAAILESEGVREAEINIAEGKRKSRILASEAERQEHI 242
            |.::   |..|...||.|: |.||:|              |:..:.:.|:         |:::.|
Human   184 ITELSFSREYTAAVEAKQVAQQEAQR--------------AQFLVEKAKQ---------EQRQKI 225

  Fly   243 NKASGEAAAIIAVADA-----------RARSLLAIAKSLSHLDGQNAASLT 282
            .:|.|||.|...:.:|           :.|:...|:|:::  ..||...||
Human   226 VQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIA--TSQNRIYLT 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 25/150 (17%)
SPFH_paraslipin 80..188 CDD:259811 16/121 (13%)
Band_7_C 266..326 CDD:292817 6/17 (35%)
PHB2NP_001138303.1 Necessary for transcriptional repression. /evidence=ECO:0000269|PubMed:10359819 19..49
SPFH_prohibitin 40..235 CDD:259799 37/203 (18%)
LC3-interaction region. /evidence=ECO:0000269|PubMed:28017329 121..124 0/2 (0%)
Necessary for transcriptional repression. /evidence=ECO:0000269|PubMed:10359819 150..174 2/23 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.