DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Orcokinin and F46C5.10

DIOPT Version :9

Sequence 1:NP_611852.2 Gene:Orcokinin / 37806 FlyBaseID:FBgn0034935 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_871958.1 Gene:F46C5.10 / 259451 WormBaseID:WBGene00009785 Length:116 Species:Caenorhabditis elegans


Alignment Length:91 Identity:27/91 - (29%)
Similarity:39/91 - (42%) Gaps:19/91 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VVSVFLNFIHAAPGVDISNDELLDGKYLCEAGSKKYDGPFIVRLI-----SAANG-----QTVVC 63
            ||...:.||.|||.:|.::...||..|  :...||.:.....|||     .|.:|     .::..
 Worm     8 VVIFVIPFILAAPEIDSNSSSGLDVLY--KKLIKKQESVKNSRLIDFISKGAPSGVDAPIPSIAE 70

  Fly    64 YECSQSEFKTKYSVKQCAAGKIGSGH 89
            ||    .||:..||...:.   |:||
 Worm    71 YE----TFKSDKSVNFLSD---GAGH 89



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158326
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.890

Return to query results.
Submit another query.