DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphas and Gna12

DIOPT Version :9

Sequence 1:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_112296.1 Gene:Gna12 / 81663 RGDID:71018 Length:379 Species:Rattus norvegicus


Alignment Length:369 Identity:135/369 - (36%)
Similarity:199/369 - (53%) Gaps:26/369 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRILHVDGFSDSEKKQKIDDIK 84
            :..:|||..|...|.::::..|...::||||||||||||.:|||||:|...|......:..|.|.
  Rat    32 REARRRSRDIDALLARERRAVRRLVKILLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIF 96

  Fly    85 KNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQDYASSPDFNYPPEFYE----HTEELWKDK 145
            .||......:..|...|..|  .:..|||....::..:.:.......|..::    ....||:|.
  Rat    97 DNILKGSRVLVDARDKLGIP--WQHSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDS 159

  Fly   146 GVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTSGIFETRFQVDKVNFHMF 210
            |:.:.:.|.:|:||.:..|||||.:..|...||.|::||||..|..|.||.|..|.:.|:.|.|.
  Rat   160 GIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMV 224

  Fly   211 DVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRLRESLDLFKSIWNNRWLRTISI 275
            ||||||.:|:||.|||:.:|:|:|:.:.|.|:.||.||...|||.||:::|::|.||:....:||
  Rat   225 DVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSI 289

  Fly   276 ILFLNKQDLLAEKIKAGKSKLSEYFSEFNKYQTPIDTGDAIMESNDDPEVIRAKYFIRDEFLRIS 340
            ||||||.|||.||:|:  ..:.::|.:|.        ||.  ...:|.:....:.|.|....|  
  Rat   290 ILFLNKMDLLVEKVKS--VSIKKHFPDFK--------GDP--HRLEDVQRYLVQCFDRKRRNR-- 340

  Fly   341 TASGDGKHYCYPHFTCAVDTENIKRVFNDCRDIIQRMHLRQYEL 384
                 ||. .:.|||.|:|||||:.||:..:|.|.:.:|:...|
  Rat   341 -----GKP-LFHHFTTAIDTENIRFVFHAVKDTILQENLKDIML 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 127/338 (38%)
Gna12NP_112296.1 G_alpha 40..377 CDD:214595 131/358 (37%)
G-alpha 56..373 CDD:206639 127/338 (38%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 57..70 10/12 (83%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 198..206 4/7 (57%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 221..230 6/8 (75%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 290..297 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 349..354 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.