DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphas and LOC797518

DIOPT Version :9

Sequence 1:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_021331576.1 Gene:LOC797518 / 797518 -ID:- Length:341 Species:Danio rerio


Alignment Length:380 Identity:107/380 - (28%)
Similarity:172/380 - (45%) Gaps:64/380 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRILHVDGFSDSEKKQKIDDIKKNIR 88
            :|:..|...|:::.   |....:||:|..:||.||..||:|:::.:.|:..::....:.|.:||.
Zfish     2 KRTRTIDAWLKREA---RMPLLILLVGMNDSGTSTFFKQIRLINGEDFNLKQRLGFREAIYENII 63

  Fly    89 DAILTITGAMSTLNPPVALEKKENE-PRVEYIQDYASSPDFNYPPEFYEHTE---ELWKDKGVLQ 149
            ..:..:....:.|..|  |:...|| ..:.:..|......|..|..|..:.|   .||||.|:.:
Zfish    64 QGMWVLVKERNKLGIP--LQNSANEIHEISFTSDDCLRVKFTEPSAFQPYVEAVDSLWKDSGIQE 126

  Fly   150 TYERS----NEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCR-----------VLTSGIFETR 199
            ||.||    :||.:.|..||..|.:..|...:|.|:.||||..|           ||.    :|.
Zfish   127 TYRRSDFKGHEYFICDSVKYHFDNIQRIGQLDYLPHNQDILHARSRWTTLEDMYYVLR----DTP 187

  Fly   200 FQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRLRESLDLFKSI 264
            |.|.:.:...|..      |.|:  .|.| |.|:|:...|.|:.:|.:   .|.|.:||.:||||
Zfish   188 FVVAQSSILPFIA------RMKF--NFRD-TTILFIIGSSDYDRMLYD---SNCLADSLSIFKSI 240

  Fly   265 WNNRWLRTISIILFLNKQDLLAEKIKAGKSKLSEYFSEFNKYQTPIDTGDAIMESNDDPEVIR-- 327
            .|:::..:.:|||..||.|||.||::.  :.:.::|.||                ..||..:.  
Zfish   241 INHKYYSSSTIILLFNKMDLLREKVQT--ADIRKHFPEF----------------QGDPHRLEDV 287

  Fly   328 AKYFIRDEFLRISTASGDGKHYCYPHFTCAVDTENIKRVFNDCRDIIQRMHLRQY 382
            .|:.::...:|....||.    .|.|...|||||||:.|:|..:..|...:.:.:
Zfish   288 QKFLVQSFKMRKLKNSGP----IYYHMITAVDTENIRTVYNTIKHAILSKNFKDF 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 103/355 (29%)
LOC797518XP_021331576.1 G-alpha 21..334 CDD:206639 103/352 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.