DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphas and gnav1

DIOPT Version :9

Sequence 1:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001159486.1 Gene:gnav1 / 571305 ZFINID:ZDB-GENE-081031-92 Length:362 Species:Danio rerio


Alignment Length:394 Identity:148/394 - (37%)
Similarity:203/394 - (51%) Gaps:41/394 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MG-CFGSPTSKQSDVNSEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMR 64
            || |.|      |:|.:|:.|..|..|..|.|.|.:..:......::|||||.||||||:||||:
Zfish     1 MGLCLG------SEVTTEEDKKAKIHSSQIDRDLYEYAKRELNVVKILLLGAAESGKSTLVKQMK 59

  Fly    65 ILHVDGFSDSEKKQKIDDIKKNIRDAILT----ITGAMSTLNPPVALEKKENEPRVEYIQDYASS 125
            |:|..||:    ||::...|..:.|.:||    :...|..|.  :.|...:|:.....:......
Zfish    60 IIHSHGFT----KQELTSFKPAVLDNLLTSMKFVLHGMGVLR--INLANPKNKVHAHSVLSCGRC 118

  Fly   126 PDFN---YPPEFYEHTE-ELWKDKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDIL 186
            .|.:   :|  |..|.. .||.|.||..:..|..||:|.|.|.||.:.:..|...:|.|.|.|:|
Zfish   119 FDEDQMLFP--FIAHALCCLWADPGVRSSAARGYEYELNDSALYFFENMGRIIADDYMPTETDVL 181

  Fly   187 RCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQ 251
            |.|:.|:|:.||:|:|..:.|.|:||||||.||||||.||..|.:::||.:.|.|:|.|.|||:.
Zfish   182 RVRLRTTGVIETQFKVKHLVFRMYDVGGQRTERRKWISCFEYVRSVLFVVSLSGYDMTLVEDPSM 246

  Fly   252 NRLRESLDLFKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKSKLSEYFSEFNKYQTPIDTGDAI 316
            |||:|||.||.||.||.:.|..|:|||:||.||..|||......|..|..:|.            
Zfish   247 NRLQESLKLFSSICNNIFFRGTSMILFMNKIDLFQEKILHSGRHLRHYLPQFR------------ 299

  Fly   317 MESNDDPEVIRAKYFIRDEFLRISTASGDGKHYCYPHFTCAVDTENIKRVFNDCRDIIQRMHLRQ 381
               ..|.:|..|..||.|.|:.::.:.   ....|.|||.|.||.|::.||....|.|.:.:|..
Zfish   300 ---GADCDVDAAARFIADMFVSLNASP---SKLIYHHFTTATDTSNVQVVFQVVMDTIIKENLEA 358

  Fly   382 YELL 385
            ..||
Zfish   359 VSLL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 132/342 (39%)
gnav1NP_001159486.1 G_alpha 20..357 CDD:214595 136/362 (38%)
G-alpha 39..356 CDD:206639 132/342 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586301
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.