DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphas and gnaz

DIOPT Version :9

Sequence 1:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_005155690.2 Gene:gnaz / 564915 ZFINID:ZDB-GENE-090420-3 Length:355 Species:Danio rerio


Alignment Length:392 Identity:150/392 - (38%)
Similarity:206/392 - (52%) Gaps:54/392 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCFGSPTSKQSDVNSEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRI 65
            |||      :|    |.:.|...|||..|.|.|:.:.|..|...:|||||...||||||||||:|
Zfish     1 MGC------RQ----STEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKI 55

  Fly    66 LHVDGFSDSEKKQKIDDIKKNIRDAILTITGAMSTL-----NPPVALEKKENEPRVEYIQDYA-- 123
            :|..||:....|:....|..|..|::..|..|::||     ||..|.:.         :|.:|  
Zfish    56 IHSGGFNLEACKEYKPLILYNAIDSLTRIIRALATLKIDFHNPDRAYDA---------VQLFALT 111

  Fly   124 --SSPDFNYPPEFYEHTEELWKDKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDIL 186
              :.......||.....:.||.|.||.:.:.|||||.|.|...|:|:.:..|..|.|.|..:|||
Zfish   112 GPAESKGEITPELLGVMKRLWADPGVQECFCRSNEYHLEDNTAYYLNDLDRISAPEYIPTVEDIL 176

  Fly   187 RCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQ 251
            |.|.:|:||.|.:|...::.|.|.||||||.||:|||.||..||||||....|.|::.|.||...
Zfish   177 RSRDMTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQT 241

  Fly   252 NRLRESLDLFKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKSKLSEYFSEF---NKYQTPIDTG 313
            :|:.|||.||.||.||.|....|:||||||:||||||||  :..|:..|:::   |.|:      
Zfish   242 SRMAESLRLFDSICNNNWFTNTSLILFLNKKDLLAEKIK--RIPLTVCFADYKGQNTYE------ 298

  Fly   314 DAIMESNDDPEVIRAKYFIRDEFLRISTASGDGKHYCYPHFTCAVDTENIKRVFNDCRDIIQRMH 378
                         .|..:::.:|..:: .:.:.|. .|.|||||.||.||:.||:...|:|.:.:
Zfish   299 -------------EAAVYVQRQFEDLN-RNKETKE-IYSHFTCATDTSNIQFVFDAVTDVIIQNN 348

  Fly   379 LR 380
            |:
Zfish   349 LK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 135/346 (39%)
gnazXP_005155690.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.