DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphas and gnao1

DIOPT Version :9

Sequence 1:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001016995.1 Gene:gnao1 / 549749 XenbaseID:XB-GENE-921635 Length:354 Species:Xenopus tropicalis


Alignment Length:382 Identity:166/382 - (43%)
Similarity:209/382 - (54%) Gaps:35/382 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCFGSPTSKQSDVNSEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRI 65
            |||          ..|.:.::...||..|.:.|::|........:||||||||||||||||||:|
 Frog     1 MGC----------TLSAEERAALERSKQIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKI 55

  Fly    66 LHVDGFSDSEKKQKIDDIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQDYASSPDFNY 130
            :|.||||..:.||....:..|...::..|..||.||.  :....||.....:.:.|..|..:...
 Frog    56 IHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLG--IEYGDKERRADAKMVCDVVSRMEDTE 118

  Fly   131 P--PEFYEHTEELWKDKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTS 193
            |  ||.......||.|.|:.:.:.||.||||.|.|||:||.:..|...:|.|.||||||.||.|:
 Frog   119 PFSPELLSAMMRLWADSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTT 183

  Fly   194 GIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRLRESL 258
            ||.||.|....::|.:|||||||.||:|||.||.|||||||..|.|.|:.||.||.|.||:.|||
 Frog   184 GIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESL 248

  Fly   259 DLFKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKSKLSEYFSEFNKYQTPIDTGDAIMESNDDP 323
            .||.||.||::....||||||||:||.|||||  ||.|:..|.|:        ||....|.    
 Frog   249 MLFDSICNNKFFIDTSIILFLNKKDLFAEKIK--KSPLTICFPEY--------TGPNTYED---- 299

  Fly   324 EVIRAKYFIRDEFLRISTASGDGKHYCYPHFTCAVDTENIKRVFNDCRDIIQRMHLR 380
                |..:|:.:| .....|.:.:.||  |.|||.||.||:.||:...|||...:||
 Frog   300 ----AAAYIQAQF-ESKNRSPNKEIYC--HMTCATDTNNIQVVFDAVTDIIIANNLR 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 155/336 (46%)
gnao1NP_001016995.1 G-alpha 34..348 CDD:206639 155/336 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.