DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphas and gna11

DIOPT Version :9

Sequence 1:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_989150.1 Gene:gna11 / 394755 XenbaseID:XB-GENE-944497 Length:359 Species:Xenopus tropicalis


Alignment Length:370 Identity:153/370 - (41%)
Similarity:212/370 - (57%) Gaps:22/370 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRILHVDGFSDSEKKQKI 80
            ||:.|..||.:..|.:||::||:..|...:|||||.|||||||.:|||||:|..|:|:.:|:...
 Frog    12 SEEVKESKRINAEIEKQLRRDKKDSRRELKLLLLGTGESGKSTFIKQMRIIHGSGYSEEDKRGFT 76

  Fly    81 DDIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQDYASSPDFNYPPEFYEHTEELWKDK 145
            ..:.:||..|:.::..||.||..|...|:.:...:|....|......|..|  :....:.||.|.
 Frog    77 KLVFQNIFTAMQSMIRAMDTLKIPYKCEQNKANAQVVREVDVEKVCTFEQP--YVNAIKNLWSDP 139

  Fly   146 GVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTSGIFETRFQVDKVNFHMF 210
            |:.:.|:|..||||.|.|||:|..|..|..|.|.|.:||:||.||.|:||.|..|.::.:.|.|.
 Frog   140 GIQECYDRRREYQLSDSAKYYLTDVDRISKPGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMV 204

  Fly   211 DVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRLRESLDLFKSIWNNRWLRTISI 275
            ||||||.||||||.||.:||:|:|:.|.|.|:.||.|...:||:.||..||::|....|.:..|:
 Frog   205 DVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSV 269

  Fly   276 ILFLNKQDLLAEKIKAGKSKLSEYFSEFNKYQTPIDTGDAIMESNDDPEVIRAKYFIRDEFLRIS 340
            ||||||:|||.:||.  .|.|.:||.||:..|....|               |:.||...|:.::
 Frog   270 ILFLNKKDLLEDKIM--YSHLVDYFPEFDGPQRDAAT---------------AREFILKMFVDLN 317

  Fly   341 TASGDGKHYCYPHFTCAVDTENIKRVFNDCRDIIQRMHLRQYELL 385
            .   |.....|.|||||.|||||:.||...:|.|.:.:|::|.|:
 Frog   318 P---DSDKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 139/334 (42%)
gna11NP_989150.1 G-alpha 40..353 CDD:206639 139/334 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.