DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphas and gnai2a

DIOPT Version :9

Sequence 1:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001001818.1 Gene:gnai2a / 336421 ZFINID:ZDB-GENE-030131-8365 Length:355 Species:Danio rerio


Alignment Length:394 Identity:158/394 - (40%)
Similarity:214/394 - (54%) Gaps:58/394 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCFGSPTSKQSDVNSEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRI 65
            |||         .|:.|| |:...||..|.|.|::|.:......:||||||||||||||||||:|
Zfish     1 MGC---------TVSQED-KAALERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKI 55

  Fly    66 LHVDGFSDSEKKQKIDDIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQDYASSPDFN- 129
            :|.||:|:.|.||....:..|...:|:.|..||::|             ::|| :|.|.:.|.. 
Zfish    56 IHEDGYSEEECKQYRAVVFSNTIQSIMAIVKAMTSL-------------KIEY-EDSARADDARQ 106

  Fly   130 -------------YPPEFYEHTEELWKDKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPN 181
                         .|.|.......||.|:||...:.|:.||||.|.|.|:|:.:..|...:|.|.
Zfish   107 LFALSGTAEEQGILPDELANVICRLWADRGVQNCFTRAREYQLNDSAAYYLNDMERIAKADYIPT 171

  Fly   182 EQDILRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLR 246
            :||:||.||.|:||.||.|....::|.||||||||.||:|||.||..||||||..|.|:|::||.
Zfish   172 QQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVAMSAYDLVLA 236

  Fly   247 EDPTQNRLRESLDLFKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKSKLSEYFSEFNKYQTPID 311
            ||...||:.||:.||.||.||:|....||||||||:||..:||.  :|.|...|.|:        
Zfish   237 EDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEQKIT--RSSLIICFPEY-------- 291

  Fly   312 TGDAIMESNDDPEVIRAKYFIRDEFLRISTASGDGKHYCYPHFTCAVDTENIKRVFNDCRDIIQR 376
                  ...|:.|  .|..:||.:|..::......:  .|||||||.||:|::.||:...|:|.:
Zfish   292 ------PGEDNYE--EASEYIRTKFEDLNKKKETKE--IYPHFTCATDTKNVQFVFDAVTDVIIK 346

  Fly   377 MHLR 380
            .:|:
Zfish   347 NNLK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 144/348 (41%)
gnai2aNP_001001818.1 G_alpha 14..353 CDD:214595 151/371 (41%)
G-alpha 34..349 CDD:206639 144/348 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.