DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphas and cta

DIOPT Version :9

Sequence 1:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster


Alignment Length:370 Identity:134/370 - (36%)
Similarity:204/370 - (55%) Gaps:32/370 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NSEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRILHVDGFSDSE---K 76
            ::.:...|:.:|..|.:.|:|:|..:|...:|||||||||||||.:|||||:|...| |.|   :
  Fly   104 STPEELEQRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNF-DYELLLE 167

  Fly    77 KQKIDDIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQDYASSPDFNYPPEFYEHT--- 138
            .|.:  |.:|:...:..:..|...||.....:.:|.:.....:.: .:|.|.   |:|.|:.   
  Fly   168 YQSV--IYQNVIRGMQVLLDAREKLNIAWGSDGREQDAYDAKLME-CNSLDV---PKFMEYAPPI 226

  Fly   139 EELWKDKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTSGIFETRFQVD 203
            ..||:|:|:.:.:||..|:|:.|...||||.:..:..|:|.|..:|||.||..|.|::|...:|.
  Fly   227 SRLWQDRGIRRAFERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQ 291

  Fly   204 KVNFHMFDVGGQRDERRKWIQCF-NDVTAIIFVTACSSYNMVLREDPTQNRLRESLDLFKSIWNN 267
            .:.|...||||||.:|:||.:|| :.||:|||:.:.|.::.||.||...|||.||.::|.:|.||
  Fly   292 NIPFVFVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIFDTIVNN 356

  Fly   268 RWLRTISIILFLNKQDLLAEKIKAGKSKLSEYFSEFNKYQTPIDTGDAIMESNDDPEVIRAKYFI 332
            ...:.|||||||||.|||.:|:...::.:..|:..||               .:...|:..:.||
  Fly   357 ATFKGISIILFLNKTDLLEQKVCNPETDIRWYYPHFN---------------GNPHSVLDVQNFI 406

  Fly   333 RDEFLRISTASGDGKHYCYPHFTCAVDTENIKRVFNDCRD-IIQR 376
            ...|:.:..:|...:  .|.|||.|:||.||..|||..:| |:||
  Fly   407 LQMFMSVRRSSSISR--IYHHFTTAIDTRNINVVFNSVKDTILQR 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 127/341 (37%)
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 133/362 (37%)
G-alpha 133..451 CDD:206639 127/341 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455805
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D63213at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10218
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.