DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphas and Gna14

DIOPT Version :9

Sequence 1:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001013169.1 Gene:Gna14 / 309242 RGDID:1308122 Length:355 Species:Rattus norvegicus


Alignment Length:373 Identity:154/373 - (41%)
Similarity:214/373 - (57%) Gaps:28/373 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRILHVDGFSDSEKKQKI 80
            |.:.|..:|.|..|.|||::||:..|...:|||||.|||||||.:|||||:|..|:||.::|...
  Rat     8 SAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFT 72

  Fly    81 DDIKKNIRDAILTITGAMSTLNPPVALEK-KENEPRVEYIQ-DYASSPDFNYPPEFYEHTEELWK 143
            ..:.:||..|:..:..||.||......|: |||...:..:: |..|:    ...:.....::||.
  Rat    73 KLVYQNIFTAMQAMIRAMDTLRIQYTCEQNKENAQIIREVEVDKVSA----ISRDQVAAIKQLWL 133

  Fly   144 DKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTSGIFETRFQVDKVNFH 208
            |.|:.:.|:|..||||.|.|||:|..:..|..|::.|.:||:||.||.|:||.|..|.::.:.|.
  Rat   134 DPGIQECYDRRREYQLSDSAKYYLTDIDRIAMPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFR 198

  Fly   209 MFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRLRESLDLFKSIWNNRWLRTI 273
            |.||||||.||||||.||..||:|||:.|.|.|:.||.|...:||:.||..|||:|....|....
  Rat   199 MVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNS 263

  Fly   274 SIILFLNKQDLLAEKIKAGKSKLSEYFSEFNKYQTPIDTGDAIMESNDDPEVIRAKYFIRDEFLR 338
            |:||||||:|||.|||.  .|.|..||.|:        ||        ..:.::|   .||..|:
  Rat   264 SVILFLNKKDLLEEKIM--YSHLISYFPEY--------TG--------PKQDVKA---ARDFILK 307

  Fly   339 I-STASGDGKHYCYPHFTCAVDTENIKRVFNDCRDIIQRMHLRQYELL 385
            : ...:.|.:...|.|||||.|||||:.||...:|.|.:::||::.|:
  Rat   308 LYQDQNPDKEKVIYSHFTCATDTENIRFVFAAVKDTILQLNLREFNLV 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 140/337 (42%)
Gna14NP_001013169.1 G_alpha 16..353 CDD:214595 151/361 (42%)
G-alpha 36..349 CDD:206639 140/337 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.