DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphas and GNAO1

DIOPT Version :9

Sequence 1:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_066268.1 Gene:GNAO1 / 2775 HGNCID:4389 Length:354 Species:Homo sapiens


Alignment Length:382 Identity:165/382 - (43%)
Similarity:209/382 - (54%) Gaps:35/382 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCFGSPTSKQSDVNSEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRI 65
            |||          ..|.:.::...||.||.:.|::|........:||||||||||||||||||:|
Human     1 MGC----------TLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKI 55

  Fly    66 LHVDGFSDSEKKQKIDDIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQDYASSPDFNY 130
            :|.||||..:.||....:..|...::..|..||.||.  :....||.:...:.:.|..|..:...
Human    56 IHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLG--IEYGDKERKADAKMVCDVVSRMEDTE 118

  Fly   131 P--PEFYEHTEELWKDKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTS 193
            |  .|.......||.|.|:.:.:.||.||||.|.|||:||.:..|...:|.|.||||||.||.|:
Human   119 PFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTT 183

  Fly   194 GIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRLRESL 258
            ||.||.|....::|.:|||||||.||:|||.||.|||||||..|.|.|:.||.||.|.||:.|||
Human   184 GIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESL 248

  Fly   259 DLFKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKSKLSEYFSEFNKYQTPIDTGDAIMESNDDP 323
            .||.||.||::....||||||||:||..||||  ||.|:..|.|:        ||....|.    
Human   249 MLFDSICNNKFFIDTSIILFLNKKDLFGEKIK--KSPLTICFPEY--------TGPNTYED---- 299

  Fly   324 EVIRAKYFIRDEFLRISTASGDGKHYCYPHFTCAVDTENIKRVFNDCRDIIQRMHLR 380
                |..:|:.:| .....|.:.:.||  |.|||.||.||:.||:...|||...:||
Human   300 ----AAAYIQAQF-ESKNRSPNKEIYC--HMTCATDTNNIQVVFDAVTDIIIANNLR 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 153/336 (46%)
GNAO1NP_066268.1 G-alpha 34..348 CDD:206639 153/336 (46%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 35..48 11/12 (92%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 174..182 6/7 (86%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 197..206 6/8 (75%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 266..273 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 324..329 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.