DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphas and GNA12

DIOPT Version :9

Sequence 1:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_031379.2 Gene:GNA12 / 2768 HGNCID:4380 Length:381 Species:Homo sapiens


Alignment Length:390 Identity:133/390 - (34%)
Similarity:203/390 - (52%) Gaps:37/390 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GSPTSKQSDVNSEDSKSQ-KRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRILHV 68
            |....:::...:.|::.: :|||..|...|.::::..|...::||||||||||||.:|||||:|.
Human    18 GGARERRAGSGARDAEREARRRSRDIDALLARERRAVRRLVKILLLGAGESGKSTFLKQMRIIHG 82

  Fly    69 DGFSDSEKKQKIDDIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQDYASSPDFNYPPE 133
            ..|......:..|.|..||......:..|...|..|  .:..|||....::..:.:.......|.
Human    83 REFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIP--WQYSENEKHGMFLMAFENKAGLPVEPA 145

  Fly   134 FYE----HTEELWKDKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTSG 194
            .::    ....||:|.|:.:.:.|.:|:||.:..|||||.:..|...||.|::||||..|..|.|
Human   146 TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYFPSKQDILLARKATKG 210

  Fly   195 IFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRLRESLD 259
            |.|..|.:.|:.|.|.||||||.:|:||.|||:.:|:|:|:.:.|.|:.||.||...|||.||::
Human   211 IVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMN 275

  Fly   260 LFKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKSKLSEYFSEFNKYQTPIDTGDAIMESNDDPE 324
            :|::|.||:....:||||||||.|||.||:|.  ..:.::|.:|                ..||.
Human   276 IFETIVNNKLFFNVSIILFLNKMDLLVEKVKT--VSIKKHFPDF----------------RGDPH 322

  Fly   325 VIRAKYFIRDEFLRISTASGDGKHY-----CYPHFTCAVDTENIKRVFNDCRDIIQRMHLRQYEL 384
            .:       ::..|......|.|..     .:.|||.|:||||::.||:..:|.|.:.:|:...|
Human   323 RL-------EDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVRFVFHAVKDTILQENLKDIML 380

  Fly   385  384
            Human   381  380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 123/343 (36%)
GNA12NP_031379.2 G_alpha 42..379 CDD:214595 127/363 (35%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 59..72 10/12 (83%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 200..208 4/7 (57%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 223..232 6/8 (75%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 292..299 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 351..356 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.