DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphas and gpa-18

DIOPT Version :9

Sequence 1:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001293719.1 Gene:gpa-18 / 189161 WormBaseID:WBGene00020997 Length:320 Species:Caenorhabditis elegans


Alignment Length:356 Identity:82/356 - (23%)
Similarity:142/356 - (39%) Gaps:55/356 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RATHRLLLLGAGESGKSTIVKQMRILHVDGFSDSEKKQKIDDIKKNIRDAILTITGAMSTLNPPV 105
            |...|.|:||...:||::.::||...|..... ..::..:..::.|:.:....:...:..|..|:
 Worm     9 RGPIRTLVLGCMGAGKTSFIRQMVKNHTKSIC-LRRELYLYCVQLNLLNIYRELKNVIEALEIPI 72

  Fly   106 ALEKKENEPRVEYIQDYASSPDFNYPPEFYEHTEELWKDKGVLQTYE----RSNEYQLIDCAKYF 166
            :.::|:   |...:.:|.....|  ||:..|..:||: :.|:   ||    |.....|.....:.
 Worm    73 SEDQKQ---RFTQLDEYRHREVF--PPKIIEAMKELF-ESGL---YELCRLRQRILPLPQNYHFL 128

  Fly   167 LDRVSTIKNPNYTPNEQDILRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTA 231
            ..|.....||.|.|:|.:|:.....|.|:...........|.:.::.|....|.||...|:|...
 Worm   129 FQRGDDFMNPEYVPSELEIMMSYSQTCGLNRENVTCQGYKFELLEMPGHHLWRAKWADYFDDPNL 193

  Fly   232 IIFVTACSS------YNMVLREDPTQNRLRESLDLFKSIWNNRWLRTISIILFLNKQDLLAEKIK 290
            ::||...|.      ||....|:.|       :.:|:|:.||..|..:..:|..||.|...:. .
 Worm   194 VVFVIDLSELCDPAFYNKGYLENKT-------VTVFESLVNNPVLAKVYWLLLFNKADTFNDH-S 250

  Fly   291 AGKSKLSEYFSEFNKYQTPIDTGDAIMESNDDPEVIRAKYFIRDEF-LRISTASGDGKHYCYPHF 354
            ||        .:|.|....:||.|:            |:.|.|.:| .:||      |..|:||.
 Worm   251 AG--------FDFRKLANHLDTADS------------ARSFYRSQFTTKIS------KTRCFPHI 289

  Fly   355 TCAVDTENIKRVFNDCRDIIQRMHLRQYELL 385
            ...|:.:..:.|..:....|.:||..:..|:
 Worm   290 VSLVNFKESQSVMMEMFKKIGKMHRERPNLM 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 79/345 (23%)
gpa-18NP_001293719.1 G-alpha 12..309 CDD:278904 77/340 (23%)
P-loop_NTPase 12..289 CDD:304359 74/320 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10218
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.