DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphas and egl-30

DIOPT Version :9

Sequence 1:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_740789.1 Gene:egl-30 / 171751 WormBaseID:WBGene00001196 Length:355 Species:Caenorhabditis elegans


Alignment Length:374 Identity:157/374 - (41%)
Similarity:225/374 - (60%) Gaps:28/374 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRILHVDGFSDSEKKQKI 80
            ||:::.|||.:..|.:|||:||:..|...:|||||.|||||||.:|||||:|..|:|:.:|:..|
 Worm     6 SEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQGYSEEDKRAHI 70

  Fly    81 DDIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQ--DYASSPDFNYPPEFYEHTEELWK 143
            ..:.:|:..||.::..||.||:.....|.:|.:.:...::  |:.|...|..|  :..:.:|||:
 Worm    71 RLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREVDFESVTSFEEP--YVSYIKELWE 133

  Fly   144 DKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTSGIFETRFQVDKVNFH 208
            |.|:.:.|:|..||||.|.|||:|..:..:..|:|.|.||||||.||.|:||.|..|.::::.|.
 Worm   134 DSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTEQDILRVRVPTTGIIEYPFDLEQIIFR 198

  Fly   209 MFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRLRESLDLFKSIWNNRWLRTI 273
            |.||||||.||||||.||.:||:|:|:.|.|.|:.||.|...:||:.||..||::|....|....
 Worm   199 MVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDNENRMEESKALFRTIITYPWFTNS 263

  Fly   274 SIILFLNKQDLLAEKIKAGKSKLSEYFSEFNKYQTPIDTGDAIMESNDDP--EVIRAKYFIRDEF 336
            |:||||||:|||.|||.  .|.|::||.|:                 |.|  :.|.|:.||...|
 Worm   264 SVILFLNKKDLLEEKIL--YSHLADYFPEY-----------------DGPPRDPIAAREFILKMF 309

  Fly   337 LRISTASGDGKHYCYPHFTCAVDTENIKRVFNDCRDIIQRMHLRQYELL 385
            :.::.   |.....|.|||||.|||||:.||...:|.|.:.:|::|.|:
 Worm   310 VDLNP---DADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 142/338 (42%)
egl-30NP_740789.1 G_alpha 13..353 CDD:214595 152/363 (42%)
G-alpha 34..349 CDD:206639 142/338 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.