DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphas and Gna15

DIOPT Version :9

Sequence 1:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_006513296.1 Gene:Gna15 / 14676 MGIID:95770 Length:399 Species:Mus musculus


Alignment Length:391 Identity:139/391 - (35%)
Similarity:202/391 - (51%) Gaps:27/391 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRILHVDGFSDSEKKQKI 80
            :|:.|:..|....|:|.|.:.|:..|...:|||||.|||||||.:|||||:|..|:|:.:::...
Mouse    15 TEEEKTAARIDQEINRILLEQKKQEREELKLLLLGPGESGKSTFIKQMRIIHGVGYSEEDRRAFR 79

  Fly    81 DDIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQDYASSPDFNYPPEFYEHTEELWKDK 145
            ..|.:||..::..:..||..|..|.:....:....:...||......|..|  :....:.||:|.
Mouse    80 LLIYQNIFVSMQAMIDAMDRLQIPFSRPDSKQHASLVMTQDPYKVSTFEKP--YAVAMQYLWRDA 142

  Fly   146 GVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTSGIFETRFQVDKVNFHMF 210
            |:...|||..|:.|:|.|.|:|..:..|...:|.|..||:||.|:.|:||.|..|.|.|....:.
Mouse   143 GIRACYERRREFHLLDSAVYYLSHLERISEDSYIPTAQDVLRSRMPTTGINEYCFSVKKTKLRIV 207

  Fly   211 DVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRLRESLDLFKSIWNNRWLRTISI 275
            ||||||.||||||.||.:|.|:|::.:.|.|:..|.|:..:||:.|||.||.:|....|.::.|:
Mouse   208 DVGGQRSERRKWIHCFENVIALIYLASLSEYDQCLEENDQENRMEESLALFSTILELPWFKSTSV 272

  Fly   276 ILFLNKQDLLAEKIKAGKSKLSEYFSEFNK------------YQTPIDTGDAIMESNDDPEVIRA 328
            ||||||.|:|.:||..  |.|:.||..|.:            :......|..|.....|.|.  |
Mouse   273 ILFLNKTDILEDKIHT--SHLATYFPSFQEGASLLGVLADFNFLHHFPEGGTIAGPRRDAEA--A 333

  Fly   329 KYFIRDEFLRISTA---------SGDGKHYCYPHFTCAVDTENIKRVFNDCRDIIQRMHLRQYEL 384
            |.||.|.:.|:..:         .|......:.|||||.||::::.||.|.||.:...:|.:..|
Mouse   334 KSFILDMYARVYASCAEPQDGGRKGSRARRFFAHFTCATDTQSVRSVFKDVRDSVLARYLDEINL 398

  Fly   385 L 385
            |
Mouse   399 L 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 128/355 (36%)
Gna15XP_006513296.1 G-alpha 49..393 CDD:206639 124/349 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.