DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphas and Gna13

DIOPT Version :9

Sequence 1:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_034433.3 Gene:Gna13 / 14674 MGIID:95768 Length:377 Species:Mus musculus


Alignment Length:412 Identity:142/412 - (34%)
Similarity:204/412 - (49%) Gaps:81/412 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCFGSPTSKQSDVNSEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRIL 66
            ||          |.:.....|:|:|..|.:.|.::|...:...::||||||||||||.:|||||:
Mouse    17 GC----------VLTNGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRII 71

  Fly    67 HVDGFSDSEKKQKIDDIKKNIRDAILTITGAMSTLNPPVALEKKE-------------------- 111
            |...|....:::....|..|:...:..:..|...|:.|....|.:                    
Mouse    72 HGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNKNQLHGDKLMAFDTRAPMAAQGM 136

  Fly   112 NEPRVEYIQDYASSPDFNYPPEFYEHTEELWKDKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNP 176
            .|.|| ::|         |.|..    ..||:|.|:...|:|..|:||.:..|||||.:..:..|
Mouse   137 VETRV-FLQ---------YLPAI----RALWEDSGIQNAYDRRREFQLGESVKYFLDNLDKLGVP 187

  Fly   177 NYTPNEQDILRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSY 241
            :|.|::||||..|..|.||.|..|::..|.|.|.||||||.||::|.:||:.||:|:|:.:.|.:
Mouse   188 DYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEF 252

  Fly   242 NMVLREDPTQNRLRESLDLFKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKSKLSEYFSEFNKY 306
            :.||.||...|||.|||::|::|.|||....:||||||||.|||.||::.  ..:.:||.||   
Mouse   253 DQVLMEDRQTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKVQV--VSIKDYFLEF--- 312

  Fly   307 QTPIDTGDAIMESNDDPEVIR--AKYFI-------RDEFLRISTASGDGKHYCYPHFTCAVDTEN 362
                         ..||..:|  .|:.:       ||:..|          ..|.|||.|::|||
Mouse   313 -------------EGDPHCLRDVQKFLVECFRGKRRDQQQR----------PLYHHFTTAINTEN 354

  Fly   363 IKRVFNDCRDIIQRMHLRQYEL 384
            |:.||.|.:|.|...:|:|..|
Mouse   355 IRLVFRDVKDTILHDNLKQLML 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 130/363 (36%)
Gna13NP_034433.3 G_alpha 29..375 CDD:214595 137/387 (35%)
G-alpha 49..371 CDD:206639 130/363 (36%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 50..63 10/12 (83%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 195..203 4/7 (57%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 218..227 6/8 (75%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 287..294 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 347..352 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.