DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphas and gnal

DIOPT Version :9

Sequence 1:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_012819842.2 Gene:gnal / 100216229 XenbaseID:XB-GENE-480551 Length:501 Species:Xenopus tropicalis


Alignment Length:369 Identity:264/369 - (71%)
Similarity:310/369 - (84%) Gaps:3/369 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRILHVDGFSDSEKKQKID 81
            |..|..|:.|.:|.|.|::.|:.|:.||||||||||||||||||||||||||:||:..||||||.
 Frog   136 EAEKEAKKVSKSIDRVLKEQKREYKQTHRLLLLGAGESGKSTIVKQMRILHVNGFNSEEKKQKIQ 200

  Fly    82 DIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQDYASSPDFNYPPEFYEHTEELWKDKG 146
            ||:||::|||:||..|||||.|||:|...||:.||:||:..|...||:|..||::|.::||.|.|
 Frog   201 DIRKNVKDAIVTIVSAMSTLIPPVSLANSENQFRVDYIKSIAPLSDFDYTQEFFDHAQKLWDDDG 265

  Fly   147 VLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTSGIFETRFQVDKVNFHMFD 211
            |...:||||||||||||:|||:|:..::..:|||.:||:||||||||||||||||||||||||||
 Frog   266 VKACFERSNEYQLIDCAQYFLERIDHVRQNDYTPTDQDLLRCRVLTSGIFETRFQVDKVNFHMFD 330

  Fly   212 VGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRLRESLDLFKSIWNNRWLRTISII 276
            ||||||||||||||||||||||||.|.||||||:|||...|||||:|||||||||||||||||:|
 Frog   331 VGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNNTNRLREALDLFKSIWNNRWLRTISVI 395

  Fly   277 LFLNKQDLLAEKIKAGKSKLSEYFSEFNKYQTPIDTGDAIMESNDDPEVIRAKYFIRDEFLRIST 341
            |||||||:||||:.|||||:.:||.|:.:|..|.|...   ::.:||:|.|||:|||||||||||
 Frog   396 LFLNKQDMLAEKVLAGKSKIEDYFPEYVRYTVPDDVSP---DTEEDPKVTRAKFFIRDEFLRIST 457

  Fly   342 ASGDGKHYCYPHFTCAVDTENIKRVFNDCRDIIQRMHLRQYELL 385
            |||||:||||||||||||||||:|||||||||||||||||||||
 Frog   458 ASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 246/334 (74%)
gnalXP_012819842.2 G-alpha 163..495 CDD:206639 246/334 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 525 1.000 Domainoid score I298
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 550 1.000 Inparanoid score I1123
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D325067at33208
OrthoFinder 1 1.000 - - FOG0004018
OrthoInspector 1 1.000 - - oto102419
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2771
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.