DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphas and gna13

DIOPT Version :9

Sequence 1:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001120411.1 Gene:gna13 / 100145489 XenbaseID:XB-GENE-6257775 Length:377 Species:Xenopus tropicalis


Alignment Length:399 Identity:142/399 - (35%)
Similarity:206/399 - (51%) Gaps:53/399 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CFGS--PTSKQSDVNSEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRI 65
            ||.:  .||::::        |:|:|..|.|.|.::|...:...::||||||||||||.:|||||
 Frog    14 CFPNCVLTSREAE--------QQRKSKEIDRCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRI 70

  Fly    66 LHVDGFSDSEKKQKIDDIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQDYASSPDFNY 130
            :|...|....|::....|..|:...|..:..|...|:.|......:....|....|..|:.....
 Frog    71 IHGQDFDLRAKEEFRATIYSNVIKGIRVLVDAREKLHIPWGDPANQKHGEVMMAFDTRSAMVAQG 135

  Fly   131 PPE---FYEH---TEELWKDKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCR 189
            ..|   |..|   ...||.|.|:...|:|..|:||.:..|||||.:..:.:.:|.|::||||..|
 Frog   136 MVETQVFVSHLLSIRSLWADTGIQTAYDRRREFQLGESVKYFLDNLDKLGDKDYLPSQQDILLAR 200

  Fly   190 VLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRL 254
            ..|.||.|..|::..|.|.|.||||||.||::|.:||:.||:|:|:.:.|.|:.||.||...|||
 Frog   201 RPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEYDQVLMEDRQTNRL 265

  Fly   255 RESLDLFKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKSKLSEYFSEFNKYQTPIDTGDAIMES 319
            .|||::|::|.|||....:||||||||.|||.||::.  ..:.:||::|                
 Frog   266 TESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKVRI--VSIKDYFADF---------------- 312

  Fly   320 NDDPEVIR--AKYFI-------RDEFLRISTASGDGKHYCYPHFTCAVDTENIKRVFNDCRDIIQ 375
            ..||..:.  .|:.:       ||:          .:...|.|||.|::||||:.||.|.:|.|.
 Frog   313 EGDPHCLEDVQKFLVNCFRNKRRDQ----------QQKPLYHHFTTAINTENIRLVFRDVKDTIL 367

  Fly   376 RMHLRQYEL 384
            ..:|:|..|
 Frog   368 HDNLKQLML 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 128/349 (37%)
gna13NP_001120411.1 G_alpha 29..375 CDD:214595 136/373 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.