DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphas and gnai1

DIOPT Version :9

Sequence 1:NP_001163283.1 Gene:Galphas / 37805 FlyBaseID:FBgn0001123 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001090865.1 Gene:gnai1 / 100038283 XenbaseID:XB-GENE-942094 Length:354 Species:Xenopus tropicalis


Alignment Length:383 Identity:156/383 - (40%)
Similarity:213/383 - (55%) Gaps:37/383 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCFGSPTSKQSDVNSEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRI 65
            |||         .:::|| |:...||..|.|.|::|.:......:||||||||||||||||||:|
 Frog     1 MGC---------TLSAED-KAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKI 55

  Fly    66 LHVDGFSDSEKKQKIDDIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQDYASSPDFNY 130
            :|..|:|:.|.||....:..|...:|:.|..||..|........:.::.|..::...|:...| .
 Frog    56 IHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDPSRADDARQLFVLAGAAEEGF-M 119

  Fly   131 PPEFYEHTEELWKDKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTSGI 195
            ..|.....:.||||.||...:.||.||||.|.|.|:|:.:..|...:|.|.:||:||.||.|:||
 Frog   120 TAELAGVIKRLWKDGGVQACFNRSREYQLNDSAAYYLNDLDRIAQNSYIPTQQDVLRTRVKTTGI 184

  Fly   196 FETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRLRESLDL 260
            .||.|....::|.||||||||.||:|||.||..||||||..|.|.|::||.||...||:.||:.|
 Frog   185 VETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKL 249

  Fly   261 FKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKSKLSEYFSEF---NKYQTPIDTGDAIMESNDD 322
            |.||.||:|....||||||||:||..||||  :|.|:..:.|:   |.|:               
 Frog   250 FDSICNNKWFTDTSIILFLNKKDLFEEKIK--RSPLTICYPEYPGSNTYE--------------- 297

  Fly   323 PEVIRAKYFIRDEFLRISTASGDGKHYCYPHFTCAVDTENIKRVFNDCRDIIQRMHLR 380
                .|..:|:.:|..::... |.|. .|.|||||.||:|::.||:...|:|.:.:|:
 Frog   298 ----EAAAYIQCQFEDLNKRK-DTKE-IYTHFTCATDTKNVQFVFDAVTDVIIKNNLK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphasNP_001163283.1 G-alpha 44..379 CDD:206639 143/337 (42%)
gnai1NP_001090865.1 G-alpha 34..348 CDD:206639 143/337 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.