DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taldo and TRA2

DIOPT Version :9

Sequence 1:NP_523835.2 Gene:Taldo / 37804 FlyBaseID:FBgn0023477 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_196846.1 Gene:TRA2 / 831183 AraportID:AT5G13420 Length:438 Species:Arabidopsis thaliana


Alignment Length:362 Identity:83/362 - (22%)
Similarity:141/362 - (38%) Gaps:96/362 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NIYKP-TD-----------ATTNPSLILSA-SSMERYQPLVQKAVEYAKGKKGSVSEQVAEAMDY 86
            |:.:| ||           .|:||::...| |:...|....:..||..|..:.:..|.|.:.:..
plant    92 NLCRPVTDLLPLIARGVRGVTSNPAIFQKAISTSNAYNDQFRTLVESGKDIESAYWELVVKDIQD 156

  Fly    87 LCVLF--------GTEILKVVPGRVSTEIDARLSFDTKKSVEKALKLIALYKSLGVDKERILIKL 143
            .|.||        |.:      |.||.|:..||:.||:.:||     .|.|.|..|::..:.||:
plant   157 ACKLFEPIYDQTEGAD------GYVSVEVSPRLADDTQGTVE-----AAKYLSKVVNRRNVYIKI 210

  Fly   144 ASTWEGIKA-AEILENEHGVHCNLTLLFSFAQAVACAEA--------GVTLISPFVGRILDWYVA 199
            .:|...|.: .:::  ..|:..|:||:||.|:..|..:|        |:..:|. |..:..::|:
plant   211 PATAPCIPSIRDVI--AAGISVNVTLIFSIARYEAVIDAYLDGLEASGLDDLSR-VTSVASFFVS 272

  Fly   200 NTDT---KKFEALKDP------GVISVTNIYNYYKKFGYK-----------------------TL 232
            ..||   |..|.:..|      |..:|......||.:..|                       |.
plant   273 RVDTLMDKMLEQIGTPEALDLRGKAAVAQAALAYKLYQQKFSGPRWEALVKKGAKKQRLLWASTS 337

  Fly   233 VMGASFRNVGEIKALAGCDLLTISP--ALLKELENETESVVTYLSVSNAK--LQDIEKITVDESR 293
            |...::.:...:..|.|.|.::..|  ||....::.........:||.|:  ...:||:.:|   
plant   338 VKNPAYSDTLYVAPLIGPDTVSTMPDQALEAFADHGIVKRTIDANVSEAEGIYSALEKLGID--- 399

  Fly   294 FRWLLNEDAMATDKLSEGIRKFAVDTVK--LENLIKT 328
              |         :|:.|.:....||:.|  .|:|:.|
plant   400 --W---------NKVGEQLEDEGVDSFKKSFESLLGT 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaldoNP_523835.2 PRK05269 12..331 CDD:235381 83/362 (23%)
TRA2NP_196846.1 PRK03343 77..434 CDD:235117 83/362 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.