DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kcc and si:cabz01102082.1

DIOPT Version :9

Sequence 1:NP_001286795.1 Gene:kcc / 37800 FlyBaseID:FBgn0261794 Length:1077 Species:Drosophila melanogaster
Sequence 2:XP_009301072.1 Gene:si:cabz01102082.1 / 101883658 ZFINID:ZDB-GENE-160728-40 Length:142 Species:Danio rerio


Alignment Length:138 Identity:66/138 - (47%)
Similarity:86/138 - (62%) Gaps:22/138 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   946 ADPTIEETQHHDSQNDEK----RNSIDLDGPENADTPETTSNKDESTEKADGDFKS--SVKPDEF 1004
            ||.:.|..:.|.:...:|    |::..........|||              .|:.  :::||..
Zfish    21 ADKSAEHRRVHMTWTKDKALQLRSNTHTHTQSCCSTPE--------------GFRDMLNIRPDHS 71

  Fly  1005 NVRRMHTAIKLNEVIVEKSQDAQLVIMNLPGPPREVRAERERNYMEFLEVLTEGLEKVLMVRGGG 1069
            ||||||||:|||||||.||.||:||::|:||||:  ..:.:.||||||||||||||:||:|||||
Zfish    72 NVRRMHTAVKLNEVIVNKSHDARLVLLNMPGPPK--NPDGDENYMEFLEVLTEGLERVLLVRGGG 134

  Fly  1070 REVITIYS 1077
            .|||||||
Zfish   135 SEVITIYS 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kccNP_001286795.1 2a30 49..1077 CDD:273347 64/136 (47%)
SLC12 674..1077 CDD:281515 64/136 (47%)
si:cabz01102082.1XP_009301072.1 SLC12 <80..142 CDD:281515 44/63 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594132
Domainoid 1 1.000 109 1.000 Domainoid score I6277
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.