DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kcc and slc12a6

DIOPT Version :9

Sequence 1:NP_001286795.1 Gene:kcc / 37800 FlyBaseID:FBgn0261794 Length:1077 Species:Drosophila melanogaster
Sequence 2:XP_009298223.2 Gene:slc12a6 / 100330290 ZFINID:ZDB-GENE-160113-148 Length:226 Species:Danio rerio


Alignment Length:207 Identity:125/207 - (60%)
Similarity:156/207 - (75%) Gaps:2/207 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   667 KYRKIFSFATQLKAGKGLTICVSVIKGDHTKITNKAVDAKATLRKYMTDEKVKGFCDVLVAQQIG 731
            |..::.:||:||||||||||..:||.|:......:|:.|:.||:..|..|:||||...:|||:..
Zfish     7 KSPRLLTFASQLKAGKGLTIVGTVIPGNFLHTYGEALAAEQTLKHLMEKERVKGFVQCIVAQKPR 71

  Fly   732 EGLSSVIQTIGLGGMKPNTVIIGWPYSWRQ-EGRNSWKTFIQTVRTVAACHMALMVPKGINFYPE 795
            ||:|.:||:.||||||.|||::|||::||| |...||||||.|||.....|:||:|.|.|:.:|.
Zfish    72 EGISHMIQSSGLGGMKHNTVVMGWPHAWRQSEDPQSWKTFINTVRVTTTAHLALLVLKNISLFPS 136

  Fly   796 SNHK-IGGNIDIWWIVHDGGLLMLLPFLLKQHRTWRNCKLRIFTVAQIEDNSIQMKKDLKTFLYH 859
            ::.. ..|.|||||||||||:||||||||:||:.||.|.||||||||:|||||||||||.|||||
Zfish   137 NSEACTEGFIDIWWIVHDGGMLMLLPFLLRQHKVWRKCALRIFTVAQMEDNSIQMKKDLATFLYH 201

  Fly   860 LRIEADVEVVEM 871
            |||:|.||||||
Zfish   202 LRIDAAVEVVEM 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kccNP_001286795.1 2a30 49..1077 CDD:273347 125/207 (60%)
SLC12 674..1077 CDD:281515 124/200 (62%)
slc12a6XP_009298223.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594108
Domainoid 1 1.000 126 1.000 Domainoid score I5335
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110005at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.