DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nap1 and TSPYL5

DIOPT Version :10

Sequence 1:NP_477128.1 Gene:Nap1 / 37798 FlyBaseID:FBgn0015268 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_277047.2 Gene:TSPYL5 / 85453 HGNCID:29367 Length:417 Species:Homo sapiens


Alignment Length:164 Identity:36/164 - (21%)
Similarity:68/164 - (41%) Gaps:49/164 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PAPVQNRIVFLKNLQLQHLNIEAQFFEDVYKLEQKY-QVQYQPLFDKRREIIEGKVDPAEEKPQW 113
            |...:..:..|:|:||:..|:.||......:|.:|: |::.|.| ::|..:|:            
Human   195 PPATEGSMDTLENVQLKLENMNAQADRAYLRLSRKFGQLRLQHL-ERRNHLIQ------------ 246

  Fly   114 KEPESSTDNEADAEHFREALSSLKSIPKDAKGIPGFWLTVFRNTAIMSEMVQPHDEPAIRKLIDI 178
                                           .|||||...|:|...::..:...::..:..|..:
Human   247 -------------------------------NIPGFWGQAFQNHPQLASFLNSQEKEVLSYLNSL 280

  Fly   179 SIKYDNGHS---YTLEFHFDKNEYFSNSVLTKQY 209
            .:: :.|.:   |.::|:||:|.||.|.||.|:|
Human   281 EVE-ELGLARLGYKIKFYFDRNPYFQNKVLIKEY 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nap1NP_477128.1 NAP 55..322 CDD:460010 35/159 (22%)
TSPYL5NP_277047.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..112
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..202 1/6 (17%)
PTZ00007 213..382 CDD:471807 31/146 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 391..417
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.