DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nap1 and TSPYL1

DIOPT Version :9

Sequence 1:NP_001246485.1 Gene:Nap1 / 37798 FlyBaseID:FBgn0015268 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_003300.1 Gene:TSPYL1 / 7259 HGNCID:12382 Length:437 Species:Homo sapiens


Alignment Length:275 Identity:56/275 - (20%)
Similarity:103/275 - (37%) Gaps:88/275 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LEQKYQVQYQPLFDKRREIIEG---KVDPAEEKPQW-------KEPESSTDNEADA--------- 126
            :|::.:|:.||...:..|:.|.   :.:..||:..|       .:|..:...|.|.         
Human   186 MEEQMEVEEQPPEGEEIEVAEEDRLEEEAREEEGPWPLHEALRMDPLEAIQLELDTVNAQADRAF 250

  Fly   127 -----------EHFREALSSLKSIPKDAKGIPGFWLTVFRNTAIMSEMVQPHDEPAIRKLIDISI 180
                       .|:.|..:.:      .:.|||||:|.|||...:|.|::..|...:|.:.::.:
Human   251 QQLEHKFGRMRRHYLERRNYI------IQNIPGFWMTAFRNHPQLSAMIRGQDAEMLRYITNLEV 309

  Fly   181 KYDNGHSYT---LEFHFDKNEYFSNSVLTKQYVLKST---VDPNDPFAFEGPEIYKCTGCTINWE 239
            | :..|..|   .:|.|.:|.||.|.::.|:|.::|:   |..:.|               |.| 
Human   310 K-ELRHPRTGCKFKFFFRRNPYFRNKLIVKEYEVRSSGRVVSLSTP---------------IIW- 357

  Fly   240 KKMNLTVKTIRKKQKHKERGAVRTIVKQVPTDSFFNFFSPPEVPSDQEEVDDDSQQILATDFEIG 304
                        ::.|:.:..:|.  .|....|||.:||...:|...               :|.
Human   358 ------------RRGHEPQSFIRR--NQDLICSFFTWFSDHSLPESD---------------KIA 393

  Fly   305 HFLRARIIPKAVLYY 319
            ..::..:.|..:.||
Human   394 EIIKEDLWPNPLQYY 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nap1NP_001246485.1 NAP 55..321 CDD:279323 56/275 (20%)
TSPYL1NP_003300.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81
NAP 228..409 CDD:279323 47/233 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152039
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.