DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nap1 and Tspyl4

DIOPT Version :10

Sequence 1:NP_477128.1 Gene:Nap1 / 37798 FlyBaseID:FBgn0015268 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_084479.1 Gene:Tspyl4 / 72480 MGIID:106393 Length:406 Species:Mus musculus


Alignment Length:286 Identity:60/286 - (20%)
Similarity:96/286 - (33%) Gaps:108/286 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 APVQNRIVFLKNLQLQHLNIEAQFFEDVYKLEQKYQVQYQPLFDKRREIIEGKVDPAEEKPQWKE 115
            ||..|.:..|:.:..:..|:.||......:||:|:. :.:.|..:||..|               
Mouse   190 APKINCMDSLEAIDQELSNVNAQADRAFLQLERKFG-RMRRLHMQRRSFI--------------- 238

  Fly   116 PESSTDNEADAEHFREALSSLKSIPKDAKGIPGFWLTVFRNTAIMSEMVQPHDEPAIRKLIDISI 180
                                       .:.|||||:|.|||...:|.|:...||..:|.:|::.:
Mouse   239 ---------------------------IQNIPGFWVTAFRNHPQLSPMISGQDEDMMRYMINLEV 276

  Fly   181 ----------KYDNGHSYTLEFHFDKNEYFSNSVLTKQYVLKST---VDPNDPFAFEGPEIYKCT 232
                      |:        :|.|..|.||.|..|.|:|..:|:   |..:.|            
Mouse   277 EELKQPRVGCKF--------KFIFQSNPYFRNEGLVKEYERRSSGRVVSLSTP------------ 321

  Fly   233 GCTINWEKKMNLTVKTIRKKQKHKERGAVRTIVKQVPTDSFFNFFSPPEVPSDQEEVDDDSQQIL 297
               |.|.:.        ::.|.|..|......:     .||||:||              ...:|
Mouse   322 ---IRWHRG--------QEPQAHIHRNREGNTI-----PSFFNWFS--------------DHSLL 356

  Fly   298 ATDFEIGHFLRARIIPKAVLYY-TGD 322
            ..| .|...::..:....:.|| .||
Mouse   357 EFD-RIAEIIKGELWSNPLQYYLMGD 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nap1NP_477128.1 NAP 55..322 CDD:460010 56/280 (20%)
Tspyl4NP_084479.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..121
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..189
PTZ00007 218..378 CDD:471807 50/253 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..406
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.