DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nap1 and Nap1l5

DIOPT Version :9

Sequence 1:NP_001246485.1 Gene:Nap1 / 37798 FlyBaseID:FBgn0015268 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001037758.1 Gene:Nap1l5 / 688843 RGDID:1584123 Length:155 Species:Rattus norvegicus


Alignment Length:151 Identity:40/151 - (26%)
Similarity:64/151 - (42%) Gaps:43/151 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PAEGHVDPESCNEIEDEKSGSD------------------CQSMPAYMNSVMRRQYLQQMVKMLP 50
            |||...:.|   .:|..:.|.|                  .::.|...|         ..::.||
  Rat     9 PAESRAEDE---VMEGAQGGEDAATGDSATAPAAEEPQAPAENAPKPKN---------DFIESLP 61

  Fly    51 APVQNRIVFLKNLQLQHLNIEAQFFEDVYKLEQKYQVQYQPLFDKRREI----------IEGKVD 105
            .||:.|::.||.||.:...|||:|.::...||:||...|:||..|.:|:          :||:.|
  Rat    62 NPVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKIQELTGEMEGCAWTLEGEDD 126

  Fly   106 PAEEKPQWKEPESSTDNEADA 126
            ..:|:   :|.|...:.||.|
  Rat   127 EDDEE---EEDEEEEEEEAAA 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nap1NP_001246485.1 NAP 55..321 CDD:279323 27/82 (33%)
Nap1l5NP_001037758.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..60 9/62 (15%)
NAP 67..>106 CDD:298680 16/38 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..155 9/29 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345537
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.