DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nap1 and mil

DIOPT Version :9

Sequence 1:NP_001246485.1 Gene:Nap1 / 37798 FlyBaseID:FBgn0015268 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_651592.2 Gene:mil / 43343 FlyBaseID:FBgn0267366 Length:283 Species:Drosophila melanogaster


Alignment Length:302 Identity:101/302 - (33%)
Similarity:153/302 - (50%) Gaps:73/302 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LKNLQLQHLNIEAQFFEDVYKLEQKYQVQYQPLFDKRREIIEGKVDPAEEKPQWKEPESSTDNEA 124
            ||.|.|:.:|::.....|:|.:|:||:.::..:||||::|::               |....|..
  Fly    37 LKQLYLETINLDVALQRDIYNIEKKYEDKHNIIFDKRKKILD---------------EFRKQNHG 86

  Fly   125 DAEHFREALSSLKSIPKDAKGIPGFWLTVFRNTAIMSEMVQPHDEPAIRKLIDIS--------IK 181
            |.|              ..:.:|.|||.|.:  |..:|.:...||..:..|.||.        :|
  Fly    87 DVE--------------TNQSVPNFWLRVLK--ASYTEFISKRDEKILECLSDIRSRLYNEPVVK 135

  Fly   182 YDNGHSYTLEFHFDKNEYFSNSVLTKQYVLKSTVDPNDPFAFEGPEIYKCTGCTINWEKKMNLTV 246
            :|      :|||||.|:||:|:||||.|.|....||:||.|::|.|||||.||.|:|::..:.| 
  Fly   136 FD------IEFHFDPNDYFTNTVLTKTYFLNCLPDPDDPLAYDGAEIYKCEGCVIDWKQTKDQT- 193

  Fly   247 KTIRKKQKHKERGAVRTIVKQVPTDSFFNFFSPPEVPSDQEEVD-DDSQQILATDFEIGHFLRAR 310
                 |.:::|             .|||.|||||.:|.|..:.: .|...:|..|||:|.:|:.|
  Fly   194 -----KTENQE-------------PSFFEFFSPPLLPEDTLDPNYCDVNAMLQNDFEVGFYLKER 240

  Fly   311 IIPKAVLYYTGDIVD--------DEDDEDEEEYDENEEDEYD 344
            :|||||:::||:|.|        .|.::.|:|.|..|||..|
  Fly   241 VIPKAVIFFTGEIADCQSSSGSETESEDTEDESDAEEEDGVD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nap1NP_001246485.1 NAP 55..321 CDD:279323 89/269 (33%)
milNP_651592.2 NAP 37..251 CDD:279323 89/269 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447475
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1507
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1216172at2759
OrthoFinder 1 1.000 - - FOG0000988
OrthoInspector 1 1.000 - - mtm1101
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.