DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nap1 and Set

DIOPT Version :9

Sequence 1:NP_001246485.1 Gene:Nap1 / 37798 FlyBaseID:FBgn0015268 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_650438.2 Gene:Set / 41844 FlyBaseID:FBgn0014879 Length:269 Species:Drosophila melanogaster


Alignment Length:354 Identity:82/354 - (23%)
Similarity:142/354 - (40%) Gaps:110/354 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 APAEGHVDPESCNEIEDEKSGSDCQSMPAYMNSVMRRQYLQQMVKMLPAPVQNRIVFLKNLQLQH 67
            |||:|:....:.|..|:.::                   |:|:     ...||        ::..
  Fly    13 APADGNTSAAAGNNEEESEA-------------------LEQI-----DACQN--------EIDA 45

  Fly    68 LNIEAQFFEDVYKLEQKYQVQYQPLFDKRREIIEGKVDPAEEKPQWKEPESSTDNEADAEHFREA 132
            ||.:|.  |::.|:||||....:|.::||.|::                                
  Fly    46 LNEKAS--EEILKVEQKYNKLRKPCYEKRSELV-------------------------------- 76

  Fly   133 LSSLKSIPKDAKGIPGFWLTVFRNTAIMSEMVQPHDEPAIRKLIDISIK--YDNGHSYTLEFHFD 195
                       |.||.||:|.|.|...:|.::...:|..:..|..:.::  .|....|.:.||||
  Fly    77 -----------KRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFD 130

  Fly   196 KNEYFSNSVLTKQYVLKSTVDPNDPFAFEGPEIYKCTGCTINWEKKMNLTVKTIRKKQKHKERGA 260
            :|.||.|.||||::.|.|..      |.|..:....|...|.|::..||....:.|...:|::  
  Fly   131 ENPYFENKVLTKEFHLNSAA------ASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKK-- 187

  Fly   261 VRTIVKQVPTDSFFNFFSPPEVPSDQEEVDDDSQQILATDFEIGHFLRARIIPKAVLYY-TGDIV 324
                 :.....:||::||     .:.:.|:|          ||...::..:.|..:.|| ..|| 
  Fly   188 -----RNSEYKTFFDWFS-----DNTDPVND----------EIAELIKDDLWPNPLQYYLVPDI- 231

  Fly   325 DDEDDEDEEEYDENEEDEYDDDDAPPPKG 353
             :.:.||||:.::|:|:.:||:|....:|
  Fly   232 -EVEPEDEEDNEDNDEEAFDDEDGEDGEG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nap1NP_001246485.1 NAP 55..321 CDD:279323 61/268 (23%)
SetNP_650438.2 NAP 31..227 CDD:279323 63/300 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456668
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.