DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nap1 and CG3708

DIOPT Version :9

Sequence 1:NP_001246485.1 Gene:Nap1 / 37798 FlyBaseID:FBgn0015268 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_569871.2 Gene:CG3708 / 31039 FlyBaseID:FBgn0040345 Length:362 Species:Drosophila melanogaster


Alignment Length:341 Identity:130/341 - (38%)
Similarity:196/341 - (57%) Gaps:28/341 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AEGHVDPESCNEIEDEKSGSDCQSM-------------PAYMNSVMRRQYLQQMVKMLPAPVQNR 56
            |||....:|..|...:......:|:             ||.:.:..|:.:|:.|:..|..|||||
  Fly     8 AEGVTQEDSHTESRADGISGSLRSLGTYTQESTEPALSPADLPARSRKAFLRHMIGQLAEPVQNR 72

  Fly    57 IVFLKNLQLQHLNIEAQFFEDVYKLEQKYQVQYQPLFDKRREIIEGKVD-PAEEKPQWKEPESST 120
            |..|::.|||.:.|..|||.:||:||:::..|...|||.||:|:||.|: |.:.:..|  ||...
  Fly    73 IRALRHNQLQQVRISEQFFREVYELERRFYGQSCALFDARRDILEGSVEPPIQTEKTW--PEDPQ 135

  Fly   121 D----NEADAEHFREALSSLKSIPKDAKGIPGFWLTVFRNTAIMSEMVQPHDEPAIRKLIDISIK 181
            |    :..:.|..|:....|..:.....|:|.||||||:|..::||:||.||||.:..|:|:.:.
  Fly   136 DALYLDFGNNEELRQLRQKLAPVSPTTLGVPRFWLTVFQNVPLLSELVQDHDEPLLESLMDVRLA 200

  Fly   182 YDNGHSYTLEFHFDKNEYFSNS--VLTKQYVLKSTVDPNDPFAFEGPEIYKCTGCTINWEKKMNL 244
            ||. .||.:.|.|..|.:..:|  :|||:|.|:.:.||..||.||||||.:|.||.|:|....||
  Fly   201 YDQ-DSYMVIFQFRPNSFLHDSSLLLTKRYFLQHSADPEYPFLFEGPEIVRCEGCHIHWRDGSNL 264

  Fly   245 TVKTIRKKQKHKERGAVRTIVKQVPTDSFFNFFSPPEVPSDQEEVDDDSQQILATDFEIGHFLRA 309
            |::|:..:::::    ...:.|.:|.:|||.||:||:. .|....|:.::.||..|||:|..||.
  Fly   265 TLQTVESRRRNR----AHRVTKVMPRESFFRFFAPPQA-LDLSLADEKTKLILGNDFEVGFLLRT 324

  Fly   310 RIIPKAVLYYTGDIVD 325
            :|:|||||:||||:||
  Fly   325 QIVPKAVLFYTGDLVD 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nap1NP_001246485.1 NAP 55..321 CDD:279323 110/272 (40%)
CG3708NP_569871.2 NAP 71..336 CDD:279323 110/272 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447473
Domainoid 1 1.000 165 1.000 Domainoid score I1209
eggNOG 1 0.900 - - E1_KOG1507
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I1355
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1216172at2759
OrthoFinder 1 1.000 - - FOG0000988
OrthoInspector 1 1.000 - - mtm1101
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X426
109.900

Return to query results.
Submit another query.