DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nap1 and Tspyl1

DIOPT Version :9

Sequence 1:NP_001246485.1 Gene:Nap1 / 37798 FlyBaseID:FBgn0015268 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001013051.1 Gene:Tspyl1 / 29544 RGDID:1307726 Length:379 Species:Rattus norvegicus


Alignment Length:321 Identity:65/321 - (20%)
Similarity:112/321 - (34%) Gaps:113/321 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ESCNEIEDEKSGSDCQSMPAYMNSVMRRQ------YLQQMVKMLPAPVQNRIVFLKNLQLQHLNI 70
            |...|:|.:.:|.:.: ||.........|      :|...::..|         |:.:||:...:
  Rat   130 EEVMEVEQKPAGEEME-MPEASGGAREAQEEAGPWHLGIDLRTNP---------LEAIQLELDTV 184

  Fly    71 EAQFFEDVYKLEQKYQVQYQPLFDKRREIIEGKVDPAEEKPQWKEPESSTDNEADAEHFREALSS 135
            .||.......||||:....:...::|..||:                                  
  Rat   185 NAQADRAFQHLEQKFGRMRRHYLERRNYIIQ---------------------------------- 215

  Fly   136 LKSIPKDAKGIPGFWLTVFRNTAIMSEMVQPHDEPAIRKLIDISIKYDNGHSYT---LEFHFDKN 197
                     .|||||:|.|||...:|.|::..|...:|.:.::.:| :..|..|   .:|.|.:|
  Rat   216 ---------NIPGFWMTAFRNHPQLSAMIRGQDAEMLRYITNLEVK-ELRHPKTGCKFKFFFRRN 270

  Fly   198 EYFSNSVLTKQYVLKST---VDPNDPFAFEGPEIYKCTGCTINWEKKMNLTVKTIRKKQKHKERG 259
            .||.|.::.|:|.::|:   |..:.|               |.|             :..|:.:.
  Rat   271 PYFRNKLIVKEYEVRSSGRVVSLSTP---------------IIW-------------RSGHEPQS 307

  Fly   260 AVRTIVKQVPTDSFFNFFSPPEVP-SDQEEVDDDSQQILATDFEIGHFLRARIIPKAVLYY 319
            .:|.  .:....|||.:||...|| ||:                |...::..:.|..:.||
  Rat   308 FIRR--NRDLICSFFTWFSDHSVPESDR----------------IAEIIKEDLWPNPLQYY 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nap1NP_001246485.1 NAP 55..321 CDD:279323 56/272 (21%)
Tspyl1NP_001013051.1 NAP 170..351 CDD:279323 57/280 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345552
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.