DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nap1 and Nap1l3

DIOPT Version :9

Sequence 1:NP_001246485.1 Gene:Nap1 / 37798 FlyBaseID:FBgn0015268 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_596893.1 Gene:Nap1l3 / 170914 RGDID:620990 Length:536 Species:Rattus norvegicus


Alignment Length:484 Identity:125/484 - (25%)
Similarity:184/484 - (38%) Gaps:166/484 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SCNEIEDEKSGSDCQS-----------MPAYMNSVMRRQYLQQMVKMLPAPVQNRIVFLKNLQLQ 66
            |.:......|||...|           :|.......||...:..:..||..|:||:..|:|:|.:
  Rat    56 SSSSSSSSSSGSSGSSSNGSHLHQKKRVPGPSRRAQRRPSGKLFMDKLPQAVRNRVQALRNIQNE 120

  Fly    67 HLNIEAQFFEDVYKLEQKYQVQYQPLFDKRREIIEGKVDPAEEKPQW------------------ 113
            ...::..|...::.||:||....:||:|||.:||..:.:|.||:.:|                  
  Rat   121 CDKVDTLFLRAIHDLERKYAELNKPLYDKRFQIINAEYEPTEEECEWNSEEEFSGDEEMQDDTPN 185

  Fly   114 --------------------KE---------PESSTDNEADAEHFREALSSLKSIPKDA------ 143
                                ||         ||:..:.|...:...|..:..|.|||:.      
  Rat   186 EMPPLEGEEEEEIGKENTEVKEEVKDVPEEVPEAKVEEEEAPKETSEVKTEEKEIPKEGPEEKAE 250

  Fly   144 ----------------------------------------------------------------- 143
                                                                             
  Rat   251 EQESSKEFPEVKVEEKTDSTDCIDIAPEEKEDLKDVTQANAEYTDQPTEDSTPRAPVREAQKRVP 315

  Fly   144 ------------------------KGIPGFWLTVFRNTAIMSEMVQPHDEPAIRKLIDISIKYDN 184
                                    :|||.:||||.:|...:..|:|..|||.::.|.|:|:|:.|
  Rat   316 ETRPEERVNIKRARKGKPKKEDPPRGIPDYWLTVLKNVDKLGPMIQKCDEPILKFLSDVSLKFSN 380

  Fly   185 -GH--SYTLEFHFDKNEYFSNSVLTKQYVLKSTVDPNDPFAFEGPEIYKCTGCTINWEKKMNLTV 246
             |.  |||.||||..|.||.|.:|.|.|:::|..|..|||...|.||.:|.||.|:|.:..::||
  Rat   381 PGQPISYTFEFHFLPNPYFRNELLMKTYIIRSKPDHYDPFFAWGWEIEECKGCKIDWRRGKDVTV 445

  Fly   247 KTIRKKQKHKERGAVRTIVKQVPTDSFFNFFSPPEVP-SDQEEVDDDSQQILATDFEIGHFLRAR 310
            .|   :.:....|.:....:.||..||||||||||:| ..:.|..:|:  ||..|||||..|...
  Rat   446 TT---RSRPAITGEIEVQPRVVPNASFFNFFSPPEIPLIGKLEPKEDA--ILDEDFEIGQILHDN 505

  Fly   311 IIPKAVLYYTGDIVD----DEDDEDEEEY 335
            :|.|::.|:||:|.|    |..|....:|
  Rat   506 VILKSIYYFTGEINDPYYHDFRDYGNRKY 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nap1NP_001246485.1 NAP 55..321 CDD:279323 107/411 (26%)
Nap1l3NP_596893.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104 8/47 (17%)
NAP 109..>149 CDD:298680 12/39 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..338 14/177 (8%)
eIF3_subunit 204..>266 CDD:285763 10/61 (16%)
NAP 345..516 CDD:279323 73/175 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345546
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1216172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11875
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X426
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.