DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and LIPG

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_005258447.1 Gene:LIPG / 9388 HGNCID:6623 Length:536 Species:Homo sapiens


Alignment Length:366 Identity:74/366 - (20%)
Similarity:133/366 - (36%) Gaps:63/366 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DGTHSKLNLKYAILRQKQAAKATQNDTLAHQQRI-KYDAQKTMKVMFYKNNTKTMETSAYDDAYD 83
            :|:..||.|..:.|..::|.:.........:.:: |..|.:|......:.|.:|.:...::..|.
Human    38 EGSGRKLELLESQLPAERAREEAGPSVRRPRDKLHKPKATQTEVKPSVRFNLRTSKDPEHEGCYL 102

  Fly    84 LSG-----SGCS--PTDKFAIVLHGWIQS-CSDEWALSLIERL-SYYRGGCVICIDYSVVASSSY 139
            ..|     ..||  .|.|...::|||..| ..:.|...|:..| :..:...|:.:|:..:|.   
Human   103 SVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVVVDWLPLAH--- 164

  Fly   140 MRLYTNFDTLTGAISSIILTLF-----RQGFDPKRGYMFGFSFGGQLASAVGRSLRPHHIIESID 199
             :|||:....|..:...|..:.     :..|.....::.|:|.|..:|...|..::  ..:..|.
Human   165 -QLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGNFVK--GTVGRIT 226

  Fly   200 TCDMAGPGF--------------DPIAVDHSKAGK------------HVQCFHSSRDKGTFVYSC 238
            ..|.|||.|              |.:.|.|:....            |:..:.:.   |.|...|
Human   227 GLDPAGPMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNG---GDFQPGC 288

  Fly   239 HRNIMLGSC--GLKQPSVASQLHLGSHGLCVDIYINTFDYPFYAVNYTPPE------CFTWQKTA 295
            ..|.:|||.  |.....|..:.....| |.||..:|. |.|.:|...|...      |.:.:|..
Human   289 GLNDVLGSIAYGTITEVVKCEHERAVH-LFVDSLVNQ-DKPSFAFQCTDSNRFKKGICLSCRKNR 351

  Fly   296 KIPDGYTVGYEENFDSQVTGQIFVPTSLHYPYNLSKKQLKL 336
            ....||..   :...::...::::.|....|:.:...|:|:
Human   352 CNSIGYNA---KKMRNKRNSKMYLKTRAGMPFRVYHYQMKI 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 34/157 (22%)
LIPGXP_005258447.1 Pancreat_lipase_like 85..376 CDD:238363 62/304 (20%)
lipo_lipase 86..521 CDD:132274 65/318 (20%)
PLAT_LPL 383..519 CDD:238856 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.