DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_114470.1 Gene:Pnliprp1 / 84028 RGDID:620792 Length:473 Species:Rattus norvegicus


Alignment Length:287 Identity:51/287 - (17%)
Similarity:95/287 - (33%) Gaps:66/287 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TMKVMFYKNNTKTMETSAYDDAYDLSGSGCSPTDKFAIVLHGWIQSCSDEWALSLIERLSYYRGG 124
            |..:::...|....:|....|...:..|......|...::||:|....:.|.:.:.:.:......
  Rat    54 TRFLLYTNENPTAFQTLQLSDPLTIGASNFQVARKTRFIIHGFIDKGEENWVVDMCKNMFQVEEV 118

  Fly   125 CVICIDYSVVASSSYMRLYTNFDTLTGAISSIILTLFRQ-GFDPKRGYMFGFSFGGQLASAVGRS 188
            ..||:|:...:.::|.:...|...:...::.:|..|.:. .:.|.:.::.|.|.|..:|...|..
  Rat   119 NCICVDWKKGSQTTYTQAANNVRVVGAQVAQMIDILVKNYSYSPSKVHLIGHSLGAHVAGEAGSR 183

  Fly   189 LRPHHIIESIDTCDMAGPG------FDP-----IAVDHSKAGK--------------HVQCFHSS 228
            ......|..:|..:....|      .||     :.|.|:.|..              |:..|.:.
  Rat   184 TPGLGRITGLDPVEANFEGTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQMSGHLDFFPNG 248

  Fly   229 RDKGTFVYSCHRNIMLGSCGLKQPSVASQLHLGSHGLCVD---IYINTFD---------YPFYAV 281
               |..:..|.:|.:            ||:        ||   |:..|.|         |.:|..
  Rat   249 ---GQSMPGCKKNAL------------SQI--------VDIDGIWSGTRDFVACNHLRSYKYYLE 290

  Fly   282 NYTPPECFTWQKTAKIPDGYTVGYEEN 308
            :...|:.|.....|...|     :|.|
  Rat   291 SILNPDGFAAYPCASYKD-----FESN 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 25/150 (17%)
Pnliprp1NP_114470.1 Lipase 18..353 CDD:395099 51/287 (18%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.