DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and Pnlip

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_081201.2 Gene:Pnlip / 69060 MGIID:97722 Length:465 Species:Mus musculus


Alignment Length:332 Identity:64/332 - (19%)
Similarity:117/332 - (35%) Gaps:75/332 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 AQKTMKVMFYKNNTKTMETSAYDDAYDLSGSGCSPTDKFAIVLHGWIQSCSDEWALSLIERLSYY 121
            ||...:.:.|.|...........||.::..|......|..|::||:|....:.|...:.:.:...
Mouse    49 AQINTRFLLYTNENPDNYQLITSDASNIRNSNFRTNRKTRIIIHGFIDKGEENWLSDMCKNMFRV 113

  Fly   122 RGGCVICIDYSVVASSSYMRLYTNFDTLTGAISSIILTLFRQ--GFDPKRGYMFGFSFGGQLASA 184
            .....||:|:...:.::|.:...|. .:.||..::::.:.:.  |:.....::.|.|.|..:|..
Mouse   114 ESVNCICVDWKGGSRTTYTQATQNV-RVVGAEVALLVNVLQSDLGYSLNNVHLIGHSLGSHIAGE 177

  Fly   185 VGRSLRPHHIIESIDTCDMAGPGF---------DP-----IAVDHSKAGKHVQ--CFHSSRDKGT 233
            .|:  |....|..|...|.|.|.|         ||     :...|:.||..:.  .|..|:..|.
Mouse   178 AGK--RTFGAIGRITGLDPAEPYFQGTPEEVRLDPTDAQFVDAIHTDAGPIIPNLGFGMSQTVGH 240

  Fly   234 FVYSCHRNIMLGSCGLKQPSVASQL-----------------HLGSHGLCVDIYINTFDYPFYAV 281
            ..:..:..|.:..|   |.::.||:                 ||.|:....|..:|...:..::.
Mouse   241 LDFFPNGGIEMPGC---QKNILSQIVDIDGIWEGTRNFAACNHLRSYKFYTDSIVNPTGFAGFSC 302

  Fly   282 N----YTPPECFTW----------------QKTAKIPDGY--TVGYEENF------------DSQ 312
            :    :|..:||..                .||:::...:  ..|.:.||            ..:
Mouse   303 SSYSLFTANKCFPCGSGGCPQMGHYADRYPGKTSRLYQTFYLNTGDKSNFARWRYQVTVTLSGQK 367

  Fly   313 VTGQIFV 319
            |||.|.|
Mouse   368 VTGHILV 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 30/145 (21%)
PnlipNP_081201.2 Lipase 18..352 CDD:278576 57/308 (19%)
Pancreat_lipase_like 51..348 CDD:238363 54/302 (18%)
PLAT_PL 355..465 CDD:238857 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.