DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and CG34447

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster


Alignment Length:321 Identity:69/321 - (21%)
Similarity:113/321 - (35%) Gaps:87/321 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KTMKVMFYKNNTKTMETSAYDDAYDLSGSGCSPTDKFAIVLHGWIQSCSDEWALS------LIER 117
            |.:....|.|:|:  |.....|..||:.....|.....|::||:  :...::|.:      |::.
  Fly    40 KNISFWLYSNSTR--ENPILLDPLDLNPWNFQPPRPLKILIHGY--TGDRDFAPNSYIRPVLLDH 100

  Fly   118 LSYYRGGCVICIDYS-VVASSSYMRLYTNFDTLTGAISSIILTLFRQGFDPK-RGYMFGFSFGGQ 180
            ...|    ||.|||. :|....|::...|...::..::.:|..|..:..... :.::.|||.|||
  Fly   101 EDVY----VISIDYGPLVRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVANDQIHLIGFSLGGQ 161

  Fly   181 LASAVGRSLRPHHIIESIDTCDMAGPGF--------------DPIAVDHS--------KAGKHVQ 223
            :|......::  ..::.|...|.|.|.|              |.:.|.|:        :|..||.
  Fly   162 VAGQTANYVK--RKMKRITGLDPAKPLFILGPDSRRLDKGDADFVDVIHTDVFGRGYLRAAGHVD 224

  Fly   224 CFHSSRDKGTFVYSCHRNIMLGSCGLKQPSVASQLHLGSHGLCVDIYINTFDYP-FYA------V 281
            .:                   .:.|.|||....: ::.....|     |....| |||      |
  Fly   225 FY-------------------PNFGAKQPGCMEE-NMQDPSSC-----NHERAPRFYAESINTTV 264

  Fly   282 NYTPPECFTW--QKTAKIPD-------GYTVGYEENFDSQVTGQIFVPTSLHYPYNLSKKQ 333
            .:...:|..|  |.....|.       ||.|      ..::.|..|:.|:...||.|.|.|
  Fly   265 GFWARQCSGWLLQLLTLCPTTGAQALLGYHV------SDELRGSYFLQTASKSPYALGKMQ 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 35/151 (23%)
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 63/308 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.