DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and pnliprp2

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001015812.1 Gene:pnliprp2 / 548529 XenbaseID:XB-GENE-5776210 Length:471 Species:Xenopus tropicalis


Alignment Length:319 Identity:66/319 - (20%)
Similarity:116/319 - (36%) Gaps:45/319 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TMKVMFYKNNTKTMETSAYDDAYDLSGSGCSPTDKFAIVLHGWIQSCSDEWALSLIERLSYYRGG 124
            |..::|.|.|..|.:.........:|.|....:.|...::||:|:...|.|...:...|......
 Frog    54 TRFLLFTKENPDTFQEIRALTPGAISTSNFKASRKTRFIIHGFIEHGYDRWLTHMCATLLKVEDV 118

  Fly   125 CVICIDYSVVASSSYMRLYTNFDTLTGAISSIILTLFRQ-GFDPKRGYMFGFSFGGQLASAVGRS 188
            ...|:|::..|.:.|.:...|...:...::..|..|..| |:.....::.|.|.|...|...|:.
 Frog   119 NCFCVDWTGGAYALYSQAANNVRVVGAEVAHFIQFLSNQYGYSAANVHVIGHSLGSHAAGETGKR 183

  Fly   189 LRPHHIIESIDTCDMAGPGFD----PIAVDHSKAGKHVQCFHS-------------SRDKGTFVY 236
            ...   |..|...|.|||.|.    .:.:|.|.| :.|...|:             .:..|...:
 Frog   184 TPG---IARITGLDPAGPFFQNTPPEVRLDQSDA-QLVDVIHTDASAIFPLTGFGIGQSVGHLDF 244

  Fly   237 SCHRNIMLGSCGLKQPSVA----SQLHLGSHGLCVDIYINTFDYPFYAVNYTPPECF-----TWQ 292
            ..:....:..| .|.|::.    .::..||..:....:|.:  |.||..:...|:.|     :..
 Frog   245 YPNGGKNMPGC-KKSPTLKYLDNYRIFKGSKEIIFCSHIRS--YKFYTESILTPDAFVAFPSSDY 306

  Fly   293 KTAKIPDGY--------TVG-YEENFDSQVTGQI--FVPTSLHYPYNLSKKQLKLLTKG 340
            ||.|...|:        .:| |.|.|....:|.:  |:.|....|:...:.::.:.|.|
 Frog   307 KTFKKGTGFPCPSGGCPLMGHYAEEFLGPTSGNLSFFLNTGNSEPFARWRYRVTVRTTG 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 33/144 (23%)
pnliprp2NP_001015812.1 Lipase 18..352 CDD:278576 63/304 (21%)
PLAT 355..466 CDD:320707 2/11 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.