DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and PNLIPRP2

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_005387.3 Gene:PNLIPRP2 / 5408 HGNCID:9157 Length:469 Species:Homo sapiens


Alignment Length:304 Identity:59/304 - (19%)
Similarity:106/304 - (34%) Gaps:69/304 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KVMFYKN---NTKTMETSAYDDAYDLSGSGCSPTDKFAIVLHGWIQSCSDEWALSLIERLSYYRG 123
            :.:.|.|   |...:.|....|..:.|........:|  ::||::....|.|...:.:::.....
Human    55 RFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRF--IIHGFLDKAEDSWPSDMCKKMFEVEK 117

  Fly   124 GCVICIDYSVVASSSYMRLYTNFDTLTGAISSIILTLFRQ-GFDPKRGYMFGFSFGGQLASAVGR 187
            ...||:|:...:.:.|.:...|...:....:.:|..|..| |:..:..::.|.|.|...|:..||
Human   118 VNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGR 182

  Fly   188 SLRPHHIIESIDTCDMAGPGF------------DPIAVD--HS---------------KAGKHVQ 223
            .|...  :..|...|.|||.|            |.:.||  |:               |.| |:.
Human   183 RLGGR--VGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVG-HLD 244

  Fly   224 CFHSSRDKGTFVYSCHRNIMLGSCGLKQPSVASQLHLGSHGLCVDIYINTFDYPFYAVNYTPPEC 288
            .|.:.   |..:..|.:|:      |...:....:..|..|.....::.:|:|            
Human   245 FFPNG---GKEMPGCKKNV------LSTITDIDGIWEGIGGFVSCNHLRSFEY------------ 288

  Fly   289 FTWQKTAKIPDGYTVGYE-ENFDSQVTGQIF------VPTSLHY 325
              :..:...|||: :||. .::|.....:.|      .|...||
Human   289 --YSSSVLNPDGF-LGYPCASYDEFQESKCFPCPAEGCPKMGHY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 32/147 (22%)
PNLIPRP2NP_005387.3 Lipase 18..354 CDD:395099 59/304 (19%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 93..105 3/11 (27%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 257..279 4/27 (15%)
PLAT_PL 357..469 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.