DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and PNLIPRP1

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001290064.1 Gene:PNLIPRP1 / 5407 HGNCID:9156 Length:467 Species:Homo sapiens


Alignment Length:181 Identity:34/181 - (18%)
Similarity:67/181 - (37%) Gaps:14/181 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TMKVMFYKNNTKTMETSAYDDAYDLSGSGCSPTDKFAIVLHGWIQSCSDEWALSLIERLSYYRGG 124
            |..:::...|....:.....|...:..|......|...::||:|....:.|...:.::|......
Human    54 TRFLLYTNENPNNFQILLLSDPSTIEASNFQMDRKTRFIIHGFIDKGDESWVTDMCKKLFEVEEV 118

  Fly   125 CVICIDYSVVASSSYMRLYTNFDTLTGAISSII-LTLFRQGFDPKRGYMFGFSFGGQLASAVGRS 188
            ..||:|:...:.::|.:...|...:...::.:: :.|....:.|.:.::.|.|.|..:|...| |
Human   119 NCICVDWKKGSQATYTQAANNVRVVGAQVAQMLDILLTEYSYPPSKVHLIGHSLGAHVAGEAG-S 182

  Fly   189 LRPHHIIESIDTCDMAGPGFDPIAVDHSKAGKHVQCFHSSRDKGTFVYSCH 239
            ..|.  :..|       .|.||:........:.|:...|..|   ||...|
Human   183 KTPG--LSRI-------TGLDPVEASFESTPEEVRLDPSDAD---FVDVIH 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 24/144 (17%)
PNLIPRP1NP_001290064.1 Lipase 18..353 CDD:278576 34/181 (19%)
Pancreat_lipase_like 52..349 CDD:238363 34/181 (19%)
PLAT_PL 356..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.