DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and CG17191

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster


Alignment Length:355 Identity:71/355 - (20%)
Similarity:109/355 - (30%) Gaps:101/355 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IDGTHSKLNLKYA--ILRQKQAAKATQNDTLAHQQRIKYDAQKTMKVMFYKNNTKTMETSAYDDA 81
            |||:...::.:.|  :|.:....:...||               :....|..:..|:......||
  Fly    34 IDGSFEWMDKQDAEELLNRNSLIETRSND---------------VSFYLYTKHNPTVGKEIRADA 83

  Fly    82 YDLSGSGCSPTDKFAIVLHGWIQSCSDEWALSLIERLSYYRGGCVICIDYSVVASSSYMRLYTNF 146
            ..:..|..........|:|||               ...|..|..:.|..:.::...|..:..|:
  Fly    84 SSIEDSHFDKNQGTRFVIHGW---------------NGRYTDGMNVKITRAWLSKGDYNVIVVNW 133

  Fly   147 DTLTGA--ISSIILTLFRQGFDPKRGYM-----------------FGFSFGGQLASAVGRSL--- 189
            |.....  |||:...   .|...|.|.|                 .|.|.|..:|...|:.:   
  Fly   134 DRAQSVDYISSVRAV---PGAGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHVAGYAGKQVGGK 195

  Fly   190 RPHHIIESIDTCDMAGPGF------------DPIAVDHSKAGKHVQCFHSSRDKGTFVYSCHRNI 242
            |.|.|:    ..|.|.|.|            |...|:..:.....:.|.....||||..:..|| 
  Fly   196 RVHTIV----GLDPAMPLFAYDKPDKRLSTEDAFYVESIQTNGGEKGFLKPIGKGTFYPNGGRN- 255

  Fly   243 MLGSCGLKQPSVASQLHLG---SHGLCVDIYIN--TFDYPFYAVNYTPPECFTWQ-----KTAKI 297
                    ||...|.  :|   :||..|..|:.  |.|      |:...:|..:|     :....
  Fly   256 --------QPGCGSD--IGGTCAHGRSVTYYVEAVTED------NFGTIKCHDYQAALANECGST 304

  Fly   298 PDGYTVGYEENFDSQVTGQIFVPTSLHYPY 327
            ..|..:|...| ...|.|..:||.:...|:
  Fly   305 YSGVRMGAVTN-AYMVDGDFYVPVNGQAPF 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 33/165 (20%)
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 64/320 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.