DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and CG6295

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:385 Identity:77/385 - (20%)
Similarity:127/385 - (32%) Gaps:106/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQLFSSFHSILIVCCVLL------------------IDGTHSKLNLKYAILRQKQAAKATQNDTL 47
            |:||     :.:..|||.                  .|||...::.::|     :|...|:|   
  Fly     2 MKLF-----LALAFCVLAANAVEVRVNGENGWYVPQADGTMEWMDREFA-----EAYLETKN--- 53

  Fly    48 AHQQRIKYDAQKTMK-VMFY----KNNTKTMETSAYDDAYDLSGSGCSPTDKFAIVLHGWIQSCS 107
                  :.:.:..:. |.||    .|.....|..|  .:..:|||..:|.......:||| .|..
  Fly    54 ------RMEGRNVLNPVTFYLYTNSNRNSPQEIKA--TSASISGSHFNPNHPTRFTIHGW-SSSK 109

  Fly   108 DEWALSLIERLSYYRGG--CVICIDYSVVASSSYMRLYTNFDTLTGAISSII-LTLFRQGFDPKR 169
            ||: ::...|.:::..|  .:|.:|:....|..|.........:...::::| ......|.:...
  Fly   110 DEF-INYGVRDAWFTHGDMNMIAVDWGRARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDN 173

  Fly   170 GYMFGFSFGGQLASAVGRSLRP---HHIIESIDTCDMAGPGFDPI--AVDHSKAGKHVQCFHSSR 229
            ..:.|.|.|..::...|::::.   |.||           |.||.  ...:....|.:    ||.
  Fly   174 TMVIGHSLGAHVSGYAGKNVKNGQLHTII-----------GLDPALPLFSYDSPNKRL----SST 223

  Fly   230 DK----------GT--FVYSCHRNIMLGSCGLKQPSVASQLHLGS--HGLCVDIYI-----NTF- 274
            |.          ||  |:....:.....:.|..||.....| .||  |...|..|.     |.| 
  Fly   224 DAYYVESIQTNGGTLGFLKPIGKGAFYPNGGKSQPGCGVDL-TGSCAHSRSVIYYAESVTENNFP 287

  Fly   275 -----DYPFYAVNYTPPECFTWQKTAKIPDGYTVGYEENFDSQVTGQIFVPTSLHYPYNL 329
                 ||.    .....||.:...:.:: ...|..|      .|.|..:||.....||.:
  Fly   288 TMRCGDYE----EAVAKECGSSYSSVRM-GATTNAY------MVAGDYYVPVRSDAPYGM 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 30/153 (20%)
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 62/296 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.