DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and CG6296

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster


Alignment Length:342 Identity:69/342 - (20%)
Similarity:119/342 - (34%) Gaps:88/342 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AHQQRIKYDAQKTMK-------VMFY----KNNTKTMETSAYDDAYDLSGSGCSPTDKFAIVLHG 101
            |.:|...|:||:.::       |.||    :|.:...:..|..|:.|  ||..:|.:...|.:||
  Fly    49 AERQLEYYEAQEALEGRLSTNTVNFYLYTLQNPSTGQQIKATQDSID--GSFFNPQNPTRITIHG 111

  Fly   102 WIQSCSDEWALSLIERLSYYRGGCVICIDYSVVASSSYMRLYTNFDTLTGA------ISSIILTL 160
            |..:..|.....:.:....|....:|.:|:....|..|.      .::.||      :::::..|
  Fly   112 WNSNYKDGVNTRVADAWFQYGDYNMIAVDWLRGRSLEYA------SSVAGAPGAGKKVAALVDFL 170

  Fly   161 FRQGFDPKRGY--------MFGFSFGGQLASAVGRSLRPHHIIESIDTCDMAGPGFDPIA--VDH 215
            .       .||        :.|||.|..:|....:.:....:.:.:        |.||.:  :.:
  Fly   171 V-------EGYGMSLDTLEIVGFSLGAHVAGHTAKQVNSGKVGKVV--------GLDPASPLISY 220

  Fly   216 SKAGKHVQCFHSSRDKGTFVYSCHRNIMLGSCGLKQPSVASQLHLG----------------SHG 264
            |...|.:     |.|...:|.|...|..:  .|..||...:..::.                ||.
  Fly   221 SNTEKRL-----SSDDALYVESIQTNGAI--LGFGQPIGKASFYMNGGRSQPGCGIDITGSCSHT 278

  Fly   265 LCVDIYINTFDYPFYAVNYTPPECFTWQKTAKIPDGYT-----VGYEENFDSQVTGQIFVPTSLH 324
            ..|..|:....:.    |:...:|.:.....|...|.|     :|...|| ....|..:||.:..
  Fly   279 KAVLYYVEALLWN----NFPSIKCESSVDANKNNCGNTYSSVFMGASINF-FVAEGIFYVPVNKE 338

  Fly   325 YPYNLSKKQLKLLTKGG 341
            .||.|.:     |..||
  Fly   339 SPYGLGE-----LNSGG 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 29/161 (18%)
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 58/300 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.