DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and CG4582

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster


Alignment Length:234 Identity:56/234 - (23%)
Similarity:84/234 - (35%) Gaps:50/234 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 KNNTKTMETSAYDDAYDLSGSGCSPTDKFAIVLHGWIQSCSDEWALSLIERLSYY---RGG--CV 126
            :|...|.|.....||..|..|..||.:...|::|||:   .:|.|....|.|..|   |.|  .:
  Fly   137 QNQQFTSEPVNLYDAASLRRSRFSPFNPTRILIHGWL---GNENANMYNELLPAYFDLRNGNYNI 198

  Fly   127 ICIDYSVVASSSYMRLYTNFDTLTGAISSI--ILTLFRQGFDPKRGYMF------GFSFGGQLAS 183
            ..:|:...|.:.|:       |.:..:..:  :|..|......:.|..|      |||.|..:|.
  Fly   199 FTVDWGRGAIADYI-------TASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAG 256

  Fly   184 AVGRSLRPHHIIESIDTCDMAGPGF--------------DPIAVDHSKAGK--------HVQCFH 226
            ..|:.|:... :..|...|.|.|.|              |.:.|.|:..|.        ||..:.
  Fly   257 LAGKHLQTGR-LRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYA 320

  Fly   227 S--SRDKGTFVYSCH--RNIMLGSCGLKQPSVASQLHLG 261
            :  |:..|.|.:.|.  |..||.:..|.:......|..|
  Fly   321 NWGSQQPGCFWHECSHWRAFMLFAESLARDQATGFLSQG 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 39/153 (25%)
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 56/233 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.