DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and CG5665

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster


Alignment Length:286 Identity:60/286 - (20%)
Similarity:92/286 - (32%) Gaps:80/286 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 KFAIVLHGWIQSCSDEWALSLIERLSYYRGGCVICIDYSVVASSSYMRLYTNFDTL--------- 149
            |..|:..||..:.::..|:|:|.:....||.    :::.:|.::.|:..:..:..|         
  Fly   118 KVVILATGWTNTVNESSAISMISKAFMCRGD----VNFVIVDAADYVDTFYAWSALNTDLIGEHI 178

  Fly   150 -TGAISSIILTLFRQ-----GF--------DPKRGYMFGFSFGGQLASAVGRSLR--PHHIIESI 198
             .|....|.||..|.     ||        :....:..|.|.|..:....||:.:  ...:|..|
  Fly   179 GVGLTHLIELTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAGRTFKKLTGKLIPRI 243

  Fly   199 DTCDMAGPGFDPIAVDHSKAGKHVQCFHS-------SRDKGTFVYSCHRNI-------MLGSC-- 247
            ...|.|.|                 ||..       :|.....|...|.||       .||..  
  Fly   244 TGLDPAKP-----------------CFRREKILPGLTRGDAKLVDIIHTNIGILAKRGPLGDVDF 291

  Fly   248 --GLKQPSVASQLHLG-SHGLCVDIYINTFDYPFYAVNYTPPECFTWQKTAK--------IPDGY 301
              |...|.....|.:| ||...|: |.....||....|:...:|.:|.:..|        .|.||
  Fly   292 YPGGAHPIQPGCLTIGCSHTRAVE-YFAESAYPHQEKNFMGKKCASWDELRKRDCSAGIVSPMGY 355

  Fly   302 TVGYEENFDSQVTGQIFVPTSLHYPY 327
                  ..:.|..|..:|..:...||
  Fly   356 ------RMNPQARGIYYVDVNGWPPY 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 29/138 (21%)
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 58/279 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.